EPGN Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EPGN Antibody [NBP2-58295] - Staining of human cell line U-251 MG shows localization to nucleus & nuclear membrane. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EPGN Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPGN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EPGN Recombinant Protein Antigen (NBP2-58295PEP)

Reactivity Notes

Mouse 83%, Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EPGN Antibody - BSA Free

• epigen
• epithelial mitogen homolog (mouse)
• PRO9904
• UNQ3072/PRO9904

Background

Promotes the growth of epithelial cells. May stimulate the phosphorylation of EGFR and mitogen-activatedprotein kinases

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPGN