ER Membrane Protein Complex Subunit 10 Antibody - BSA Free

Western Blot: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611] - Analysis in human cell line SH-SY5Y.

Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611] - Staining of human Fallopian tube shows very weak positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611] - Staining of human liver shows very weak membranous positivity in hepatocytes.

Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ER Membrane Protein Complex Subunit 10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKN
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EMC10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ER Membrane Protein Complex Subunit 10 Protein (NBP2-30611PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ER Membrane Protein Complex Subunit 10 Antibody - BSA Free

• C19orf63
• Chromosome 19 Open Reading Frame 63
• EMC10
• Hematopoietic Signal Peptide-Containing Membrane Domain-Containing 1
• Hematopoietic Signal Peptide-Containing Membrane Domain-Containing Protein 1
• Hematopoietic Signal Peptide-Containing Secreted 1
• HSM1
• HSS1
• INM02
• UPF0510 Protein INM02

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EMC10
• Uniprot:
  • Q5UCC4(Human)