ERRF Antibody - BSA Free

Western Blot: C1orf64 Antibody [NBP1-81157] - Analysis in control (vector only transfected HEK293T lysate) and C1orf64 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: C1orf64 Antibody [NBP1-81157] - Staining of human breast shows weak nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ERRF Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C1ORF64
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 29577611). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ERRF Recombinant Protein Antigen (NBP1-81157PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22341523)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ERRF Antibody - BSA Free

• chromosome 1 open reading frame 64
• ERRF
• MGC24047
• putative uncharacterized protein C1orf64
• RP11-5P18.4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ERRF Antibody (NBP1-81157)(3)

Publications using NBP1-81157

• Naderi A. SRARP and HSPB7 are epigenetically-regulated gene pairs that function as tumor suppressors and predict clinical outcome in malignancies. Mol Oncol. 2018-03-26 [PMID: 29577611] (WB, Human)
• Naderi A. C1orf64 is a novel androgen receptor target gene and coregulator that interacts with 14-3-3 protein in breast cancer Oncotarget 2017-08-22 [PMID: 28915724] (WB, Human)
• Su D, Fu X, Fan S et al. Role of ERRF, a Novel ER-Related Nuclear Factor, in the Growth Control of ER-Positive Human Breast Cancer Cells. Am J Pathol 2012-03-01 [PMID: 22341523]

Bioinformatics

• Gene Symbol: C1ORF64
• Entrez:
  • 149563(Human)