FABP5/E-FABP Antibody - BSA Free

Western Blot: FABP5/E-FABP Antibody [NBP1-98462] - Titration: 1.0 ug/ml Positive Control: Mouse Thymus.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FABP5/E-FABP Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is fatty acid binding protein 5 - C-terminal region. Peptide sequence RKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FABP5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 15 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FABP5/E-FABP Antibody - BSA Free

• EFABP
• E-FABP
• E-FABPPAFABP
• FABP5
• fatty acid binding protein 5 (psoriasis-associated)
• Fatty acid-binding protein 5
• PA-FABPepidermal
• Psoriasis-associated fatty acid-binding protein homolog

Background

Fatty Acid Binding Protein 5 encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FABP5
• Uniprot:
  • NP_034764(Mouse)