![Immunocytochemistry/Immunofluorescence: FAM134B Antibody [NBP2-55248] - Staining of human cell line HeLa shows localization to nuclear bodies & endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/FAM134B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55248-img0002.jpg "Immunocytochemistry/Immunofluorescence: FAM134B Antibody [NBP2-55248] - Staining of human cell line HeLa shows localization to nuclear bodies & endoplasmic reticulum. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ENGMGTNDEDELSLGLPTELKRKKEQLDSGHRPSKETQSAAGLTLPLNSDQTFHLMSNLAGDVITAAVTAAIKDQLEGVQQALSQAAPIPEEDTDTEEGDDFELLDQSELDQIESELGLTQDQEAEAQQNKKSSG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RETREG1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-55248 | Applications | Species |
|---|---|---|
| Lim Y, Kim S, Kim EK Palmitate reduces starvation-induced ER stress by inhibiting ER-phagy in hypothalamic cells Molecular brain 2021-04-06 [PMID: 33823883] |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human and Mouse | 05/12/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 05/12/2017 |
||
| Application: | WB | |
| Species: | Human and Mouse |
| Gene Symbol | RETREG1 |
![Western Blot: FAM134B Antibody [NBP2-55248] - Palmitate inhibits EBSS-induced ER-phagy. a–c Cells transiently expressing mRFP-LC3 were starved in EBSS for 3 h in the presence or absence of palmitate (0.1 mM) & were co-treated for 3 h with Baf A1. Treated cells were stained for the ER marker KDEL. Representative micrographs (a) & quantification (b) of colocalization between mRFP-LC3 & KDEL (n = 10 per each group). Scale bar, 10 μm. Data are mean ± SEM; ****p < 0.0001 vs. control, ###p = 0.0002, ####p < 0.0001, ††††p < 0.0001. c The ratio of the average number of KDEL-positive mRFP-LC3 puncta to the total number of mRFP-LC3 puncta per cell (n = 10 per each group). Data are mean ± SEM; ****p < 0.0001 vs. control, ####p < 0.0001, ††††p < 0.0001. d & e Immunoblotting analysis (d) & quantification (e) of ER-phagy receptors & LC3-II in cells starved in EBSS for 3 h in the presence or absence of palmitate (0.1 mM) & were co-treated for 3 h with Baf A1 (FAM134B; n = 8 for control, PA, EBSS, PA + EBSS, n = 5 for control + Baf A1, PA + Baf A1, EBSS + Baf A1, PA + EBSS + Baf A1, RTN3; n = 4 per each group, CCPG1; n = 3 per each group, LC3-II; n = 9 for control, PA, EBSS, PA + EBSS, n = 4 for control + Baf A1, PA + Baf A1, EBSS + Baf A1, PA + EBSS + Baf A1). Data are mean ± SEM; FAM134B; ****p < 0.0001 vs. control, ##p = 0.0016, ††p = 0.0094, CCPG1; ****p < 0.0001 vs. control, LC3-II; *p = 0.0331, ****p < 0.0001 vs. control, ###p = 0.0002 at PA vs. PA + Baf A1, ###p = 0.0005 at PA + EBSS vs. PA + EBSS + Baf A1, ####p < 0.0001, †p = 0.0203. n.s., no significant difference Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33823883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-55248_rabbit-polyclonal-fam134b-antibody-310202416121941.jpg "Western Blot: FAM134B Antibody [NBP2-55248] - Palmitate inhibits EBSS-induced ER-phagy. a–c Cells transiently expressing mRFP-LC3 were starved in EBSS for 3 h in the presence or absence of palmitate (0.1 mM) & were co-treated for 3 h with Baf A1. Treated cells were stained for the ER marker KDEL. Representative micrographs (a) & quantification (b) of colocalization between mRFP-LC3 & KDEL (n = 10 per each group). Scale bar, 10 μm. Data are mean ± SEM; ****p < 0.0001 vs. control, ###p = 0.0002, ####p < 0.0001, ††††p < 0.0001. c The ratio of the average number of KDEL-positive mRFP-LC3 puncta to the total number of mRFP-LC3 puncta per cell (n = 10 per each group). Data are mean ± SEM; ****p < 0.0001 vs. control, ####p < 0.0001, ††††p < 0.0001. d & e Immunoblotting analysis (d) & quantification (e) of ER-phagy receptors & LC3-II in cells starved in EBSS for 3 h in the presence or absence of palmitate (0.1 mM) & were co-treated for 3 h with Baf A1 (FAM134B; n = 8 for control, PA, EBSS, PA + EBSS, n = 5 for control + Baf A1, PA + Baf A1, EBSS + Baf A1, PA + EBSS + Baf A1, RTN3; n = 4 per each group, CCPG1; n = 3 per each group, LC3-II; n = 9 for control, PA, EBSS, PA + EBSS, n = 4 for control + Baf A1, PA + Baf A1, EBSS + Baf A1, PA + EBSS + Baf A1). Data are mean ± SEM; FAM134B; ****p < 0.0001 vs. control, ##p = 0.0016, ††p = 0.0094, CCPG1; ****p < 0.0001 vs. control, LC3-II; *p = 0.0331, ****p < 0.0001 vs. control, ###p = 0.0002 at PA vs. PA + Baf A1, ###p = 0.0005 at PA + EBSS vs. PA + EBSS + Baf A1, ####p < 0.0001, †p = 0.0203. n.s., no significant difference Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33823883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: FAM134B Antibody [NBP2-55248] - Palmitate impairs ER-phagy. a & b Immunoblotting analysis (a) & quantification (b) of ER-phagy receptors (FAM134B, RTN3, & CCPG1) in cells treated with 0.1 mM palmitate for the indicated times (FAM134B & RTN3; n = 4 per each group, CCPG1; n = 3 per each group). Data are mean ± SEM; FAM134B; **p = 0.0053, ***p = 0.0005 vs. control, CCPG1; *p = 0.0388, ***p = 0.0004 vs. control. c & d Cells transiently expressing mRFP-LC3 were treated with 0.1 mM palmitate for the indicated times in the presence or absence of Baf A1 (200 nM). Treated cells were stained for the ER marker KDEL. Representative micrographs (c) & quantification (d) of colocalization between mRFP-LC3 & KDEL (n = 13 per each group). Scale bar, 10 μm. Data are mean ± SEM; **p = 0.0029, ***p = 0.0008 vs. control, ##p = 0.0025. n.s., no significant difference Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33823883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-55248_rabbit-polyclonal-fam134b-antibody-310202416121997.jpg "Western Blot: FAM134B Antibody [NBP2-55248] - Palmitate impairs ER-phagy. a & b Immunoblotting analysis (a) & quantification (b) of ER-phagy receptors (FAM134B, RTN3, & CCPG1) in cells treated with 0.1 mM palmitate for the indicated times (FAM134B & RTN3; n = 4 per each group, CCPG1; n = 3 per each group). Data are mean ± SEM; FAM134B; **p = 0.0053, ***p = 0.0005 vs. control, CCPG1; *p = 0.0388, ***p = 0.0004 vs. control. c & d Cells transiently expressing mRFP-LC3 were treated with 0.1 mM palmitate for the indicated times in the presence or absence of Baf A1 (200 nM). Treated cells were stained for the ER marker KDEL. Representative micrographs (c) & quantification (d) of colocalization between mRFP-LC3 & KDEL (n = 13 per each group). Scale bar, 10 μm. Data are mean ± SEM; **p = 0.0029, ***p = 0.0008 vs. control, ##p = 0.0025. n.s., no significant difference Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33823883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Western Blot WNK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/WNK1_AF2849_Western_Blot_5218.jpg)
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Immunohistochemistry_6672.jpg)
![Western Blot TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Western_Blot_17300.jpg)
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images/af1056_rat-trka-affinity-purified-polyclonal-ab-8220249503264.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/DATA_TIMP1_DTM100_ELISA_847.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/TIMP-1_DTM100_ELISA_194.jpg)
![Immunohistochemistry EphA3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA3_AF640_Immunohistochemistry_19184.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
