Fas Ligand/TNFSF6 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FASLG |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Fas Ligand/TNFSF6 Antibody - BSA Free
Background
Fas / APO-1 (CD95) is an important member of the tumour necrosis factor (TNF) superfamily involved in membrane-mediated apoptosis. Ligation of Fas by Fas Ligand (Fas-L) or an anti-Fas cross-linking antibody, triggers activation of the caspase cascade. Functional impairment of the Fas / Fas-L system is associated with the development and progression of malignancies. Fas gene mutations have been suggested to have a role in testicular germ cell tumours. Tumour cells frequently exhibit de novo expression of Fas Ligand (Fas-L), which plays a significant role in local tissue destruction, metastatic spread, and immune escape of the tumor cells. The apoptosis of lymphocytes, which occurs in autoimmune diseases, is usually induced by the Fas/Fas-L system. Fas is believed to be involved in various autoimmune diseases including, ulcerative colitis, Graves disease, and rheumatoid arthritis. Fas expression on gastric epithelial cells in patients infected with H.Pylori is responsible for the accelerated apoptosis of the cells. Serum Fas-L concentration has also been shown to be associated with atherosclerosis and inflammatory disease, in patients with hypertension.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC, IHC
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC
Publications for Fas Ligand/TNFSF6 Antibody (NBP2-49160) (0)
There are no publications for Fas Ligand/TNFSF6 Antibody (NBP2-49160).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Fas Ligand/TNFSF6 Antibody (NBP2-49160) (0)
There are no reviews for Fas Ligand/TNFSF6 Antibody (NBP2-49160).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Fas Ligand/TNFSF6 Antibody (NBP2-49160) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Fas Ligand/TNFSF6 Products
Research Areas for Fas Ligand/TNFSF6 Antibody (NBP2-49160)
Find related products by research area.
|
Blogs on Fas Ligand/TNFSF6