Fas Ligand/TNFSF6 Antibody - BSA Free

Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160] - Staining of human lymph node shows distinct cytoplasmic positivity in subsets of cells.

Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160] - Staining of human rectum shows moderate cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Fas Ligand/TNFSF6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FASLG
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Fas Ligand/TNFSF6 Recombinant Protein Antigen (NBP2-49160PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Fas Ligand/TNFSF6 Antibody - BSA Free

• apoptosis (APO-1) antigen ligand 1
• Apoptosis antigen ligand
• APT1LG1CD95L
• APTL
• CD178 antigen
• CD178
• CD95L
• CD95-L
• Fas antigen ligand
• Fas ligand (TNF superfamily, member 6)
• Fas Ligand
• FASLCD95 ligand
• FASLG
• TNFSF6
• TNFSF6FasL
• tumor necrosis factor (ligand) superfamily, member 6
• tumor necrosis factor ligand superfamily member 6

Background

Fas / APO-1 (CD95) is an important member of the tumour necrosis factor (TNF) superfamily involved in membrane-mediated apoptosis. Ligation of Fas by Fas Ligand (Fas-L) or an anti-Fas cross-linking antibody, triggers activation of the caspase cascade. Functional impairment of the Fas / Fas-L system is associated with the development and progression of malignancies. Fas gene mutations have been suggested to have a role in testicular germ cell tumours. Tumour cells frequently exhibit de novo expression of Fas Ligand (Fas-L), which plays a significant role in local tissue destruction, metastatic spread, and immune escape of the tumor cells. The apoptosis of lymphocytes, which occurs in autoimmune diseases, is usually induced by the Fas/Fas-L system. Fas is believed to be involved in various autoimmune diseases including, ulcerative colitis, Graves disease, and rheumatoid arthritis. Fas expression on gastric epithelial cells in patients infected with H.Pylori is responsible for the accelerated apoptosis of the cells. Serum Fas-L concentration has also been shown to be associated with atherosclerosis and inflammatory disease, in patients with hypertension.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FASLG