FCRN/FCGRT Antibody - BSA Free

Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Western blot shows lysates of 293 human embryonic kidney parental cell line and FCGRT knockout (KO) 293 cell line. PVDF membrane was probed with 1:500 of Rabbit Anti-Human FCGRT Polyclonal Antibody (Catalog # NBP1-89128) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for FCGRT at approximately 40 kDa (as indicated) in the parental 293 cell line, but is not detectable in the knockout 293 cell line. This experiment was conducted under reducing conditions.

Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Western blot shows lysates of 293 human embryonic kidney parental cell line and FCGRT knockout (KO) 293 cell line. PVDF membrane was probed with 1:500 of Rabbit Anti-Human FCGRT Polyclonal Antibody (Catalog # NBP1-89128) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for FCGRT at approximately 40 kDa (as indicated) in the parental 293 cell line, but is not detectable in the knockout 293 cell line. This experiment was conducted under reducing conditions.

Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Analysis in human cell lines Caco-2 and HeLa using anti-FCGRT antibody. Corresponding FCGRT RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.

Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Human lung epithelial A549 cells and primary bronchial epithelial cells (hAECB) lack FcgammaR (CD16, CD64, and CD32) and FcalphaR (CD89) cell surface expression as analyzed by flow cytometry (human THP1 cells as positive control). The neonatal FcR (FcRn) is expressed in both A549 cells & human THP1 cells as determined by Western blotting. Data are representative of at least two independent experiments. Absolute bacterial counts (CFUs) in human THP1 macrophages 1 h after infection with MTB preincubated with the LAM-reactive IgA1 (left) or IgG1 (right) antibody TB24PB037 or the respective isotype control antibody as indicated. Mean and SEM are indicated. Data are representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (//embomolmed.embopress.org/lookup/doi/10.15252/emmm.201606330), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining in human placental Hoffbauer cells at a 1:65 dilution. Image from a verified customer review.

Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Analysis in control (vector only transfected HEK293T lysate) and FCGRT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells.

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Immunohistochemical staining of human cerebellum shows no positivity in neuronal cells as expected.

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining of human placenta shows moderate to strong cytoplasmic positivity in Hofbauer cells.

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Simple Western: FCRN/FCGRT Antibody [NBP1-89128] - Simple Western lane view shows a specific band for FCGRT in 0.2 mg/ml of h. Liver (left), HepG2 (middle) and THP-1 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: FCRN/FCGRT Antibody [NBP1-89128] - Electropherogram image(s) of corresponding Simple Western lane view. FCRN/FCGRT antibody was used at 1:20 dilution on h. Liver, HepG2, and THP-1 lysate(s).

FcRn localization in air–liquid interface culture of human nasal epithelial cells on day 21. Cells were co-immunolabeled for FcRn (green) and (A) a basal cell marker, cytokeratin-14 (red), or (B) a goblet cell marker, mucin-5AC (red), or (C) a ciliated cell marker, acetylated alpha -tubulin (red); and imaged by confocal microscopy. White scale bars represent 5 μm.

Immunocytochemistry/ Immunofluorescence: FCRN/FCGRT Antibody [NBP1-89128] - FcRn localization in air–liquid interface culture of human nasal epithelial cells on day 21. Cells were co-immunolabeled for FcRn (green) & (A) a basal cell marker, cytokeratin-14 (red), or (B) a goblet cell marker, mucin-5AC (red), or (C) a ciliated cell marker, acetylated alpha -tubulin (red); & imaged by confocal microscopy. White scale bars represent 5 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30893823), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Pm-Cm
• Applications: WB, Simple Western, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FCRN/FCGRT Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCGRT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID 24278022).
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Knockout Validated
  • Simple Western 1:20
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in h. Liver, HepG2 (middle) and THP-1, separated by Size, antibody dilution of 1:20, apparent MW was 51, 44 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  FCRN/FCGRT Protein (NBP1-89128PEP)

  Loading...

Reactivity Notes

Cynomolgus Monkey reactivity reported in scientific literature (PMID: 31746560).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FCRN/FCGRT Antibody - BSA Free

• alpha-chain
• Fc fragment of IgG, receptor, transporter, alpha
• FCGRT
• FcRn alpha chain
• FCRN
• FCRNimmunoglobulin receptor, intestinal, heavy chain
• IgG Fc fragment receptor transporter alpha chain
• IgG receptor FcRn large subunit p51
• major histocompatibility complex class I-like Fc receptor
• Neonatal Fc receptor
• neonatal Fc-receptor for Ig

Background

The FCGRT gene encodes a 365 amino acid long, 39 kDA IgG receptor FcRn large subunit p51 protein that transfers immunoglobulin G antibodies across the placenta from mother to fetus, as well as functions to protect the antibody from degradation. FCGRT interacts with genes CA6, ELANE, AZGP1, B2M, and ALB. It has been linked to diseases such as: lupus, nephritis, leukemia, arthritis, immunodeficiency, epidermolysis bullosa acquisita, persistent fetal circulation syndrome, and pemphigus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FCRN/FCGRT Antibody (NBP1-89128)(15)

Publications using NBP1-89128

• Haga K, Tokui T, Miyamoto K et Al. Neonatal Fc receptor is a functional receptor for classical human astrovirus Genes Cells 2024-09-12 [PMID: 39266307]
• Zakrzewicz A, WUrth C, Beckert B Et al. Stabilization of Keratinocyte Monolayer Integrity in the Presence of Anti-Desmoglein-3 Antibodies through FcRn Blockade with Efgartigimod: Novel Treatment Paradigm for Pemphigus? Cells 2022-03-25 [PMID: 35326398] (WB, Human)
  
  Details:
  Citation using the Alexa Fluor 488 version of this antibody.
• Uchida Y, Torisu K, Ueki K et al. Autophagy gene ATG7 regulates albumin transcytosis in renal tubule epithelial cells American journal of physiology. Renal physiology 2021-09-20 [PMID: 34541900]
• Catlin NR, Mitchell AZ, Potchoiba MJ et al. Placental transfer of 125 iodinated humanized immunoglobulin G2 delta a in the cynomolgus monkey Birth Defects Res 2019-11-20 [PMID: 31746560] (WB, Cynomolgus Monkey)
• Bequignon E, Dhommee C, Angely C et al. FcRn-Dependent Transcytosis of Monoclonal Antibody in Human Nasal Epithelial Cells In Vitro: A Prerequisite for a New Delivery Route for Therapy? Int J Mol Sci 2019-03-19 [PMID: 30893823] (IF/IHC, Human)
• S Latvala, B Jacobsen, MB Otteneder, A Herrmann, S Kronenberg Distribution of FcRn Across Species and Tissues J. Histochem. Cytochem., 2017-04-12;0(0):2215541770509. 2017-04-12 [PMID: 28402755]
• Zimmermann N, Thormann V, Hu B et al. Human isotype-dependent inhibitory antibody responses against Mycobacterium tuberculosis. EMBO Mol Med 2016-11-02 [PMID: 27729388] (WB, Human)
• Dalloneau E, Baroukh N, Mavridis K et al. Downregulation of the neonatal Fc receptor expression in non-small cell lung cancer tissue is associated with a poor prognosis. Oncotarget. 2016-08-23 [PMID: 27384673] (WB, Human)
• Jacobsen B, Hill M, Reynaud L et al. FcRn Expression on Placenta and Fetal Jejunum during Early, Mid-, and Late Gestation in Minipigs Toxicologic Pathology 2016-04-01 [PMID: 26516163]
• Morel A, Passot C, Arnoult C et al. The neonatal Fc receptor (FcRn) does not modulate hepatitis C virus neutralization J. Gen. Virol. 2015-01-22 [PMID: 25614590] (WB, Human)
• Ko SY, Pegu A, Rudicell RS et al. Enhanced neonatal Fc receptor function improves protection against primate SHIV infection. Nature 2014-10-30 [PMID: 25119033]
• Gupta S, Gach JS, Becerra JC et al. The Neonatal Fc Receptor (FcRn) Enhances Human Immunodeficiency Virus Type 1 (HIV-1) Transcytosis across Epithelial Cells. PLoS Pathog. 2013-11-01 [PMID: 24311991] (WB, IHC-P, Human)
• Baker K, Rath T, Flak MB et al. Neonatal Fc Receptor Expression in Dendritic Cells Mediates Protective Immunity Against Colorectal Cancer. Immunity 2013-12-12 [PMID: 24290911] (IF/IHC, Human)
• Gupta S, Gach JS, Becerra JC et al. The Neonatal Fc receptor (FcRn) enhances human immunodeficiency virus type 1 (HIV-1) transcytosis across epithelial cells. PLoS Pathog 2013-11-01 [PMID: 24278022] (WB, IHC-Fr, Human)
• Seijsing J, Lindborg M, Lofblom J et al. Robust expression of the human neonatal Fc receptor in a truncated soluble form and as a full-length membrane-bound protein in fusion with eGFP. PLoS One 2013-01-01 [PMID: 24260574]

Reviews for FCRN/FCGRT Antibody (NBP1-89128) (2)

Average Rating: 4.5

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Human.

reviewed by: Jason Ray WB Human 10/16/2019

Summary

• Application: Western Blot
• Sample Tested: HepG2
• Species: Human
• Lot: N/A

reviewed by: Corey . IHC-P Human 12/04/2012

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Penile urethra and placental tissue
• Species: Human

FAQs for FCRN/FCGRT Antibody (NBP1-89128). (Showing 1 - 1 of 1 FAQs).

1. I use the anti-FcRn (Ref #NBP1-89128) and I was wondering if you have any clue about the nature of the higher slight band that we can see on the datasheet. Is it an isoform ?  ..show answer..
   • The theoretical molecular weight of FCGRT is ~39.7kDa. We typically see this antibody run true to size, as although there is a signal peptide lost, there is a glycoslation site that will make up for the lost weight. In our image on our datasheet, lane 3 is the FCGRT protein co-expressed with a C- terminal myc-DDK tag, which is why we are seeing the faint signal ~3kDa above the protein of interest.

Bioinformatics

• Gene Symbol: FCGRT
• Entrez:
  • 2217(Human)
• Uniprot:
  • P55899()