FGF basic/FGF2/bFGF Antibody - BSA Free

Images

 
Western Blot: FGF basic/FGF2 Antibody [NBP1-57096] - Antibody Titration: 2 ug/ml ELISA Titer: 1 : 312500 Positive control: Hela cell lysate.
Immunohistochemistry: FGF basic/FGF2 Antibody [NBP1-57096] - Human A375 cells Primary Antibody Dilution: 1 : 100 Secondary Antibody: Anti-rabbit-Alexa-546 Secondary Antibody Dilution: 1 : 100Color/Signal Descriptions: ...read more
Western Blot: FGF basic/FGF2 Antibody [NBP1-57096] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

FGF basic/FGF2/bFGF Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to FGF2(fibroblast growth factor 2 (basic)) The peptide sequence was selected from the middle region of FGF2. Peptide sequence RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGF2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for FGF basic/FGF2/bFGF Antibody - BSA Free

  • basic fibroblast growth factor bFGF
  • Basic fibroblast growth factor
  • bFGF
  • FGF basic
  • FGF2
  • FGF-2
  • FGFBprostatropin
  • fibroblast growth factor 2 (basic)
  • HBGF-2
  • heparin-binding growth factor 2
  • Prostatropin

Background

The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVE00
Species: Hu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
AF232
Species: Hu
Applications: IHC, Neut, Simple Western, WB
291-G1
Species: Hu
Applications: BA
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
H00002263-M01
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
294-HG
Species: Hu
Applications: BA
DBD00
Species: Hu
Applications: ELISA
251-KG
Species: Hu
Applications: BA
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
267-N3
Species: Hu
Applications: BA
256-GF
Species: Hu
Applications: BA
NBP1-57096
Species: Hu, Mu
Applications: WB, IHC

Publications for FGF basic/FGF2/bFGF Antibody (NBP1-57096) (0)

There are no publications for FGF basic/FGF2/bFGF Antibody (NBP1-57096).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF basic/FGF2/bFGF Antibody (NBP1-57096) (0)

There are no reviews for FGF basic/FGF2/bFGF Antibody (NBP1-57096). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF basic/FGF2/bFGF Antibody (NBP1-57096). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?
    • Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits , but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

Secondary Antibodies

 

Isotype Controls

Additional FGF basic/FGF2/bFGF Products

Research Areas for FGF basic/FGF2/bFGF Antibody (NBP1-57096)

Find related products by research area.

Blogs on FGF basic/FGF2/bFGF

There are no specific blogs for FGF basic/FGF2/bFGF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF basic/FGF2/bFGF Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF2