FHL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: FHL1 Antibody [NBP1-88746] - Staining of human skin shows low expression as expected.

Immunohistochemistry: FHL1 Antibody [NBP1-88746] - Staining of human skeletal muscle shows strong cytoplasmic and nuclear positivity in myocytes.

Immunohistochemistry-Paraffin: FHL1 Antibody [NBP1-88746] - Staining in human skeletal muscle and skin tissues using anti-FHL1 antibody. Corresponding FHL1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FHL1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKIRRAPPLSNN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FHL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FHL1 Recombinant Protein Antigen (NBP1-88746PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%). Reactivity reported in scientific literature (PMID: 16524965)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FHL1 Antibody - BSA Free

• bA535K18.1
• FHL1
• four and a half LIM domains 1
• HLH1
• HPLH1
• KYOT
• KYO-T
• LIM protein SLIMMER
• skeletal muscle LIM-protein1
• SLIM1
• SLIM1Isl-1 and Mec-3 domains 1
• SLIMMER
• XMPMA

Background

LIM proteins, named for 'LIN11, ISL1, and MEC3,' are defined by the possession of a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FHL1 Antibody (NBP1-88746)(1)

Publication using NBP1-88746

• Ek S, Andreasson U, Hober S et al. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Mol Cell Proteomics 2006-06-01 [PMID: 16524965]

Bioinformatics

• Gene Symbol: FHL1