FUNDC1 Antibody - BSA Free

Western Blot: FUNDC1 Antibody [NBP1-81063] - Analysis in control (vector only transfected HEK293T lysate) and FUNDC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human prostate shows moderate to strong cytoplasmic positivity in smooth muscle cells.

Western Blot: FUNDC1 Antibody [NBP1-81063] - Analysis in human cell line HEK 293.

Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FUNDC1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVM
• Predicted Species: Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FUNDC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation Reported in scientific literature (PMID:29945885)
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FUNDC1 Protein (NBP1-81063PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:30646747).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FUNDC1 Antibody - BSA Free

• FUN14 domain containing 1
• FUN14 domain-containing protein 1
• MGC51029

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FUNDC1 Antibody (NBP1-81063)(6)

Publications using NBP1-81063

• Kaur, B;Miglioranza Scavuzzi, B;Yang, M;Yao, J;Jia, L;Abcouwer, SF;Zacks, DN; ER Stress and Mitochondrial Perturbations Regulate Cell Death in Retinal Detachment: Exploring the Role of HIF1? Investigative ophthalmology & visual science 2024-09-03 [PMID: 39325470]
• Jage?i? D, Petrovi? DJ, Šimuni? I et al. The Oxygen and Glucose Deprivation of Immature Cells of the Nervous System Exerts Distinct Effects on Mitochondria, Mitophagy, and Autophagy, Depending on the Cells' Differentiation Stage Brain sciences 2023-06-04 [PMID: 37371388] (Western Blot)
• Wang C, Dai X, Wu S et al. FUNDC1-dependent mitochondria-associated endoplasmic reticulum membranes are involved in angiogenesis and neoangiogenesis Nature communications 2021-05-10 [PMID: 33972548]
• Livingston MJ, Wang J, Zhou J et al. Clearance of damaged mitochondria via mitophagy is important to the protective effect of ischemic preconditioning in kidneys Autophagy 2019-05-22 [PMID: 31066324] (WB, Human)
• Wu S, Lu Q et al. Hyperglycemia-Driven Inhibition of AMP-Activated Protein Kinase alpha 2 Induces Diabetic Cardiomyopathy by Promoting Mitochondria-Associated Endoplasmic Reticulum Membranes In Vivo. Circulation 2019-04-16 [PMID: 30646747] (WB, Mouse)
• Singh B K, Sinha R A et al. Thyroid hormone receptor and ERR alpha coordinately regulate mitochondrial fission, mitophagy, biogenesis, and function. Sci Signal 2018-06-26 [PMID: 29945885] (IP, Mouse)

Bioinformatics

• Gene Symbol: FUNDC1
• Entrez:
  • 139341(Human)
• Uniprot:
  • Q8IVP5(Human)