G2A/GPR132 Antibody - BSA Free

Immunohistochemistry-Paraffin: G2A/GPR132 Antibody [NBP1-89807] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

G2A/GPR132 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR132
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  G2A/GPR132 Protein (NBP1-89807PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for G2A/GPR132 Antibody - BSA Free

• G protein-coupled receptor 132
• G2 accumulation protein
• G2A
• G2AG protein-coupled receptor G2A
• GPR132
• MGC99642
• probable G-protein coupled receptor 132

Background

GPR132, also known as G2A (for G2 accumulation), is a seven transmembrane G protein-coupled receptor that is upregulated in response to DNA damage and stress. G2A is predominantly expressed in hematopoietic tissues and in hematopoietic stem cells, and it is more highly detected in pro-B cells, while lower expression is observed in immature B cells and pre-B cells. G2A is expressed throughout T cell maturation, and it is further increased in response to T-cell activation. Ectopic expression of a G2A fusion protein in NIH/3T3 fibroblasts induces a cell cycle arrest that is consistent with a block at the G2/M transition. G2A is also able to attenuate the proliferative effects of Bcr-Abl, a chimeric tyrosine kinase oncogene, suggesting that G2A possesses anti-oncogenic properties. The amino acid sequence of G2A contains a destruction box motif that is consistently observed in cyclins, where it is required for ubiquitination and proteolytic degradation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR132