GDF-15 Antibody - BSA Free

Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050] - Analysis in human placenta and cervix, uterine tissues using NBP1-81050 antibody. Corresponding GDF-15 RNA-seq data are presented for the same tissues.

Western Blot: GDF-15 Antibody [NBP1-81050] - Analysis in human cell line BEWO.

Immunocytochemistry/Immunofluorescence: GDF-15 Antibody [NBP1-81050] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus.

Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050] - Staining of human prostate shows moderate cytoplasmic positivity in a small subset of glandular cells.

Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050] - Staining of human placenta shows very strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: GDF-15 Antibody [NBP1-81050] - Staining of human cervix shows no positivity in squamous epithelial cells as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GDF-15 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GDF15
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation Reactivity reported in (PMID: 26114631).
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  GDF-15 Protein (NBP1-81050PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GDF-15 Antibody - BSA Free

• GDF15
• GDF-15
• growth differentiation factor 15
• growth/differentiation factor 15
• Macrophage inhibitory cytokine 1
• MIC-1
• MIC-1NSAID-activated gene 1 protein
• MIC1Prostate differentiation factor
• NAG-1
• NAG-1NSAID-regulated gene 1 protein
• NSAID (nonsteroidal inflammatory drug)-activated protein 1
• PDF
• PDFGDF-15
• PLAB
• PLABNRG-1
• Placental bone morphogenetic protein
• Placental TGF-beta
• PTGF-beta
• PTGFBPTGF-beta

Background

Growth differentiation factor 15 (GDF15) is a transforming growth factor beta superfamily member that acts to regulate inflammatory and apoptotic responses in injured or diseased tissues. GDF15 is most strongly expressed in the liver, placenta and kidney.

GDF15 antibodies are useful for studies on inflamation and immune system research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GDF-15 Antibody (NBP1-81050)(11)

Publications using NBP1-81050

• Joo M, Kim D, Lee MW et al. GDF15 Promotes Cell Growth, Migration, and Invasion in Gastric Cancer by Inducing STAT3 Activation International journal of molecular sciences 2023-02-02 [PMID: 36769245] (IHC-P, Human)
  
  Details:
  Dilution used in IHC-P 1:200
• Cao M, Gu L, Guo L et al. Elevated Expression of Growth Differentiation Factor-15 Is Associated With Acute Exacerbation of Idiopathic Pulmonary Fibrosis Frontiers in Immunology 2022-06-15 [PMID: 35784345]
• Hong W, Chen Jh, Ma Hj Et Al. Fragile X-Related Protein 1 (FXR1) Promotes Trophoblast Migration at Early Pregnancy via Downregulation of GDF-15 Expression Reproductive sciences (Thousand Oaks, Calif.) 2021-07-21 [PMID: 34291416] (ICC/IF)
• Uchiyama T, Kawabata H, Miura Y et al. The role of growth differentiation factor 15 in the pathogenesis of primary myelofibrosis. Cancer Med 2015-10-01 [PMID: 26276681] (IF/IHC, Human)
• Lee J, Fricke F, Warnken U et al. Reconstitution of TGFBR2-Mediated Signaling Causes Upregulation of GDF-15 in HCT116 Colorectal Cancer Cells. PLoS One 2015-01-01 [PMID: 26114631] (WB, IP)
• Liu X, Chi X, Gong Q et al. Association of Serum Level of Growth Differentiation Factor 15 with Liver Cirrhosis and Hepatocellular Carcinoma. PLoS One 2015-01-01 [PMID: 25996938] (IF/IHC, Human)
• Naoki Urakawa, Soken Utsunomiya, Mari Nishio et al. GDF15 derived from both tumor-associated macrophages and esophageal squamous cell carcinomas contributes to tumor progression via Akt and Erk pathways. Laboratory Investigation 2015-03-02 [PMID: 25730371] (IF/IHC, Human)
• Nickel N, Jonigk D, Kempf T et al. GDF-15 is abundantly expressed in plexiform lesions in patients with pulmonary arterial hypertension and affects proliferation and apoptosis of pulmonary endothelial cells. Respir Res. 2011-05-01 [PMID: 21548946]
• Wallin U, Glimelius B, Jirstrom K et al. Growth differentiation factor 15: a prognostic marker for recurrence in colorectal cancer. Br J Cancer. 2011-05-01 [PMID: 21468045]
• Roth P, Junker M, Tritschler I et al. GDF-15 contributes to proliferation and immune escape of malignant gliomas. Clin Cancer Res. 2010-08-01 [PMID: 20534737]
• Tabrizi AD, Kalloger SE, Kobel M et al. Primary ovarian mucinous carcinoma of intestinal type: significance of pattern of invasion and immunohistochemical expression profile in a series of 31 cases. Int J Gynecol Pathol. 2010-03-01 [PMID: 20173494]

Bioinformatics

• Gene Symbol: GDF15
• Entrez:
  • 9518(Human)
• Uniprot:
  • Q99988()