GDNF Antibody

Western Blot: GDNF Antibody [H00002668-D01P] - Analysis of GDNF expression in transfected 293T cell line by GDNF polyclonal antibody.Lane 1: GDNF transfected lysate(23.70 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

GDNF Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: GDNF (NP_000505.1, 1 a.a. - 211 a.a.) full-length human protein. MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
• Specificity: Reacts with glial cell derived neurotrophic factor.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GDNF
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GDNF Antibody

• Astrocyte-derived trophic factor
• ATF
• ATF1
• ATF2
• GDNF
• glial cell derived neurotrophic factor
• glial cell line derived neurotrophic factor
• glial cell line-derived neurotrophic factor
• HFB1-GDNF
• HGDNF
• HSCR3

Background

This gene encodes a highly conserved neurotrophic factor. The recombinant form of this protein was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. The encoded protein is processed to a mature secreted form that exists as a homodimer. The mature form of the protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. In addition to the transcript encoding GDNF, two additional alternative transcripts encoding distinct proteins, referred to as astrocyte-derived trophic factors, have also been described. Mutations in this gene may be associated with Hirschsprung disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for GDNF Antibody (H00002668-D01P). (Showing 1 - 1 of 1 FAQ).

1. Is there any cross reactivity of GDNF Antibody (H00002668) to murine GDNF- i.e. can it be used in mouse tissue to detect human GDNF (that mice were treated with)?
   • We currently offer 4 GDNF antibodies however 3 of them were raised in mouse and I would not recommend using those as you can expect high antibody cross reactivity. The only other one is the rabbit polyclonal, catalog # H00002668-D01P. This antibody is guaranteed to work in human but the cross reactivity to mouse has not been determined and I therefore cannot guarantee that it would not cross-react. I'm sorry I do not have a more definitive answer for you.

Bioinformatics

• Gene Symbol: GDNF
• Entrez:
  • 2668(Human)
• Uniprot:
  • NP_000505.1(Human)