Gliomedin Antibody - BSA Free

Immunohistochemistry-Paraffin: Gliomedin Antibody [NBP2-38873] - Staining of human soft tissue shows strong cytoplasmic positivity in peripheral nerve.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Gliomedin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ASAPPQDPASSARNKRSHSGEPAPHIRAESHDMLMMMTYSMVPIRVMVDLCNSTKGICLTGP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLDN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Gliomedin Protein (NBP2-38873PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Gliomedin Antibody - BSA Free

• CLOM
• collomin
• COLM
• colmedin
• CRGL2
• CRG-L2
• FLJ23917
• gliomedin
• UNC-112

Background

Gliomedin is a novel gene, CRG-L2 (Cancer related gene-Liver 2) displays high expression in murine and human hepatocellular carcinomas (HCC). Its restricted expression in normal tissues and unique early upregulation during tumor development make CRG-L2 an excellent candidate as a new clinical marker of HCC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLDN
• Uniprot:
  • Q6ZMI3(Human)