GLOD4 Antibody - BSA Free

Western Blot: GLOD4 Antibody [NBP1-88463] - Analysis using Anti-GLOD4 antibody NBP1-88463 (A) shows similar pattern to independent antibody NBP1-88462 (B).

Immunocytochemistry/Immunofluorescence: GLOD4 Antibody [NBP1-88463] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: GLOD4 Antibody [NBP1-88463] - Staining of human testis.

Western Blot: GLOD4 Antibody [NBP1-88463] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: GLOD4 Antibody [NBP1-88463] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GLOD4 Antibody [NBP1-88463] - Staining of human duodenum shows high expression.

Immunohistochemistry-Paraffin: GLOD4 Antibody [NBP1-88463] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: GLOD4 Antibody [NBP1-88463] - Staining in human duodenum and skeletal muscle tissues using anti-GLOD4 antibody. Corresponding GLOD4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GLOD4 Antibody [NBP1-88463] - Staining of human duodenum, kidney, skeletal muscle and testis using Anti-GLOD4 antibody NBP1-88463 (A) shows similar protein distribution across tissues to independent antibody NBP1-88462 (B).

Immunohistochemistry-Paraffin: GLOD4 Antibody [NBP1-88463] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GLOD4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLOD4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GLOD4 Protein (NBP1-88463PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GLOD4 Antibody - BSA Free

• C17orf25
• CGI-150
• chromosome 17 open reading frame 25
• glyoxalase domain containing 4
• glyoxalase domain-containing protein 4
• HC71

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLOD4