glycerol-3-phosphate permease Antibody - BSA Free

Western Blot: glycerol-3-phosphate permease Antibody [NBP1-69300] - This Anti-SLC37A1 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

glycerol-3-phosphate permease Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC37A1(solute carrier family 37 (glycerol-3-phosphate transporter), member 1) The peptide sequence was selected from the middle region of SLC37A1 (NP_061837). Peptide sequence LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFD The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC37A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 58 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for glycerol-3-phosphate permease Antibody - BSA Free

• FLJ22340
• G-3-P permease
• G-3-P transporter
• G3PPgene similar to glycerol-3-phosphate permease10Glycerol-3-phosphate permease
• glycerol-3-phosphate transporter
• solute carrier family 37 (glycerol-3-phosphate transporter), member 1
• Solute carrier family 37 member 1

Background

SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC37A1
• Entrez:
  • 54020(Human)
• Uniprot:
  • P57057(Human)