![Immunocytochemistry/Immunofluorescence: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.](http://images.novusbio.com/fullsize/Glycine-N-Methyltransferase-GNMT-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89512-img0005.jpg "Immunocytochemistry/Immunofluorescence: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNY |
| Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GNMT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Flow_Cytometry_10781.jpg)
![Western Blot FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Western_Blot_6248.jpg)
![Immunocytochemistry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Immunocytochemistry_6624.jpg)
| Publication using NBP1-89512 | Applications | Species |
|---|---|---|
| Ottaviani S, Brooke GN, O'Hanlon-Brown C et al. Characterisation of the androgen regulation of glycine N-methyltransferase in prostate cancer cells. J Mol Endocrinol 2013-12-01 [PMID: 23997240] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Glycine N-Methyltransferase/GNMT Antibody (NBP1-89512)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GNMT |
![Immunohistochemistry-Paraffin: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Staining in human pancreas and colon tissues using anti-GNMT antibody. Corresponding GNMT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Glycine-N-Methyltransferase-GNMT-Antibody-Immunohistochemistry-Paraffin-NBP1-89512-img0008.jpg "Immunohistochemistry-Paraffin: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Staining in human pancreas and colon tissues using anti-GNMT antibody. Corresponding GNMT RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Staining of human colon shows low expression as expected.](http://images.novusbio.com/fullsize/Glycine-N-Methyltransferase-GNMT-Antibody-Immunohistochemistry-Paraffin-NBP1-89512-img0006.jpg "Immunohistochemistry-Paraffin: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Staining of human colon shows low expression as expected.")
![Immunohistochemistry-Paraffin: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Staining of human pancreas shows high expression.](http://images.novusbio.com/fullsize/Glycine-N-Methyltransferase-GNMT-Antibody-Immunohistochemistry-Paraffin-NBP1-89512-img0007.jpg "Immunohistochemistry-Paraffin: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Staining of human pancreas shows high expression.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")