| Reactivity | Hu, Mu, Rt, PoSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC, IP, KD, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GSDMD |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2), 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Eric Wang |
WB | Human | 06/21/2021 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for GSDMDC1 Antibody (NBP2-33422)Find related products by research area.
|
|
The NLRP3 Inflammasome: Macrophage Activator & Pathology Driver By Victoria Osinski, PhDWhat is the NLRP3 Inflammasome?With its critical role in innate immunity, the nucleotide-binding oligomerization domain-like receptor family, pyrin domain containing 3 (NLRP3) inflammasome ... Read full blog post. |
|
Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: GSDMDC1 Antibody [NBP2-33422] - miR-513c-5p negatively regulates caspase-1 expression in HUVECs. (A) The expression of miR-513c-5p after NC, miR-513c-5p mimics, INC & miR-513c-5p inhibitor transfection was evaluated by qRT-PCR. (B) The expression level of caspase-1 mRNA after NC, miR-513c-5p mimics, INC & miR-513c-5p inhibitor transfection was detected by qRT-PCR. (C,D) Expression of caspase-1 in HUVECs were detected after transfection NC, miR-513c-5p mimics, INC, miR-513c-5p inhibitor by immunofluorescence staining (magnification, ×40). Scale bar = 200 μm. (E,F) Protein expression levels of caspase-1 & GSDMD were examined by Western blot. (G) The expression of IL-1 beta & IL-18 was detected by ELISA. *p 0.05; *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33422_rabbit-polyclonal-gsdmdc1-antibody-31020241613629.jpg "Western Blot: GSDMDC1 Antibody [NBP2-33422] - miR-513c-5p negatively regulates caspase-1 expression in HUVECs. (A) The expression of miR-513c-5p after NC, miR-513c-5p mimics, INC & miR-513c-5p inhibitor transfection was evaluated by qRT-PCR. (B) The expression level of caspase-1 mRNA after NC, miR-513c-5p mimics, INC & miR-513c-5p inhibitor transfection was detected by qRT-PCR. (C,D) Expression of caspase-1 in HUVECs were detected after transfection NC, miR-513c-5p mimics, INC, miR-513c-5p inhibitor by immunofluorescence staining (magnification, ×40). Scale bar = 200 μm. (E,F) Protein expression levels of caspase-1 & GSDMD were examined by Western blot. (G) The expression of IL-1 beta & IL-18 was detected by ELISA. *p 0.05; *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: GSDMDC1 Antibody [NBP2-33422] - Pyroptosis is occurred in mouse corneas of C. albicans keratitis. (A) RT-qPCR analysis of the mRNA levels of pyroptosis-associated genes (ASC/CASP1/GSDMD/IL-1 beta /IL-18) in mouse corneas at 0 (control), 1, 3, & 7 dpi (n = 3). (B,C) Western blot detecting pyroptosis-related proteins of ASC, cleaved CASP1, cleaved IL-1 beta , cleaved IL-18, F-GSDMD & N-GSDMD in mouse corneas at 0 (control), 1, 3, & 7 dpi (n = 3). (D) Double-immunofluorescence staining of CASP1 & TUNEL in C. albicans infected-corneas compared with mock-infected controls (n = 3; Scale bar = 20 μm; magnification 400×). CASP1: caspase-1; Clv-CASP1:cleaved CASP1; Clv-IL-1 beta :cleaved IL-1 beta ; Clv-IL-18:cleaved IL-18; F-GSDMD: p53 form of GSDMD; N-GSDMD: cleaved p30 form of GSDMD. All values are presented as mean ± SEM. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001 vs. control group. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33422_rabbit-polyclonal-gsdmdc1-antibody-310202416114767.jpg "Western Blot: GSDMDC1 Antibody [NBP2-33422] - Pyroptosis is occurred in mouse corneas of C. albicans keratitis. (A) RT-qPCR analysis of the mRNA levels of pyroptosis-associated genes (ASC/CASP1/GSDMD/IL-1 beta /IL-18) in mouse corneas at 0 (control), 1, 3, & 7 dpi (n = 3). (B,C) Western blot detecting pyroptosis-related proteins of ASC, cleaved CASP1, cleaved IL-1 beta , cleaved IL-18, F-GSDMD & N-GSDMD in mouse corneas at 0 (control), 1, 3, & 7 dpi (n = 3). (D) Double-immunofluorescence staining of CASP1 & TUNEL in C. albicans infected-corneas compared with mock-infected controls (n = 3; Scale bar = 20 μm; magnification 400×). CASP1: caspase-1; Clv-CASP1:cleaved CASP1; Clv-IL-1 beta :cleaved IL-1 beta ; Clv-IL-18:cleaved IL-18; F-GSDMD: p53 form of GSDMD; N-GSDMD: cleaved p30 form of GSDMD. All values are presented as mean ± SEM. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001 vs. control group. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: GSDMDC1 Antibody [NBP2-33422] - NLRP3 knockdown attenuates the pyroptosis in mouse C. albicans keratitis. (A–C) RT-qPCR analysis & western blot showing the mRNA & protein levels of pyroptosis-related molecules in C. albicans-infected corneas pretreated with Ad-GFP-shRNA & Ad-NLRP3- shRNA compared with mock controls (n = 3). (D) Immunofluorescence staining of ASC, CASP1 & GSDMD in C. albicans-infected corneas pretreated with Ad-GFP-shRNA & Ad-NLRP3- shRNA compared with mock controls (n = 3). (E) Double-immunofluorescence staining of CASP1 & TUNEL in the mice cornea of Ad-NLRP3-shRNA group compared with the Ad-GFP-shRNA group (n = 3). Scale bar = 20 μm; magnification 400×. FK: fungal keratitis. CASP1: caspase-1; Clv-CASP1:cleaved CASP1; Clv-IL-1 beta :cleaved IL-1 beta ; Clv-IL-18:cleaved IL-18; F-GSDMD: p53 form of GSDMD; N-GSDMD: cleaved p30 form of GSDMD. All values are presented as mean ± SEM. *p < 0.05; **p < 0.01; ***p < 0.001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33422_rabbit-polyclonal-gsdmdc1-antibody-31020241613636.jpg "Western Blot: GSDMDC1 Antibody [NBP2-33422] - NLRP3 knockdown attenuates the pyroptosis in mouse C. albicans keratitis. (A–C) RT-qPCR analysis & western blot showing the mRNA & protein levels of pyroptosis-related molecules in C. albicans-infected corneas pretreated with Ad-GFP-shRNA & Ad-NLRP3- shRNA compared with mock controls (n = 3). (D) Immunofluorescence staining of ASC, CASP1 & GSDMD in C. albicans-infected corneas pretreated with Ad-GFP-shRNA & Ad-NLRP3- shRNA compared with mock controls (n = 3). (E) Double-immunofluorescence staining of CASP1 & TUNEL in the mice cornea of Ad-NLRP3-shRNA group compared with the Ad-GFP-shRNA group (n = 3). Scale bar = 20 μm; magnification 400×. FK: fungal keratitis. CASP1: caspase-1; Clv-CASP1:cleaved CASP1; Clv-IL-1 beta :cleaved IL-1 beta ; Clv-IL-18:cleaved IL-18; F-GSDMD: p53 form of GSDMD; N-GSDMD: cleaved p30 form of GSDMD. All values are presented as mean ± SEM. *p < 0.05; **p < 0.01; ***p < 0.001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: GSDMDC1 Antibody [NBP2-33422] - Knockdown of miR-513c-5p promotes pyroptosis of VECs & DVT formation by increasing caspase-1. (A) The expression level of miR-513c-5p in vascular tissue was detected by qRT-PCR in DVT mice treated with INC, miR-513c-5p inhibitor, respectively. (B) Expression of miR-513c-5p in PBMCs was detected by qRT-PCR in DVT mice treated with INC, miR-513c-5p inhibitor, respectively. (C) Confocal microscopy images of miR-513c-5p expression in vascular tissues (miR-513c-5p, red; DAPI, blue) (magnification, ×200). Scale bars = 100 μm. (D) H&E staining of serial cross sections of inferior vena cava (IVC) from DVT mice treated with INC, miR-513c-5p inhibitor at 48 h (magnification, ×40). Scale bars = 500 μm. (E) Representative images of thrombi in each treatment group were detected by vascular ultrasound at 48 h post-operation. (F) Thrombus length & weight at 48 h post-operation in the different treatment groups (n = 15 in each group). (G) Caspase-1 mRNA level was determined by qRT-PCR in vascular tissue of each treatment group. (H) Caspase-1 & GSDMD protein levels were determined by Western blot in vascular tissue of DVT mice treated with INC, miR-513c-5p inhibitor. (I) IL-1 beta & IL-18 protein levels in vascular tissue were determined by ELISA in INC, miR-513c-5p inhibitor treated DVT mice models, respectively. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35445025), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33422_rabbit-polyclonal-gsdmdc1-antibody-310202416114772.jpg "Western Blot: GSDMDC1 Antibody [NBP2-33422] - Knockdown of miR-513c-5p promotes pyroptosis of VECs & DVT formation by increasing caspase-1. (A) The expression level of miR-513c-5p in vascular tissue was detected by qRT-PCR in DVT mice treated with INC, miR-513c-5p inhibitor, respectively. (B) Expression of miR-513c-5p in PBMCs was detected by qRT-PCR in DVT mice treated with INC, miR-513c-5p inhibitor, respectively. (C) Confocal microscopy images of miR-513c-5p expression in vascular tissues (miR-513c-5p, red; DAPI, blue) (magnification, ×200). Scale bars = 100 μm. (D) H&E staining of serial cross sections of inferior vena cava (IVC) from DVT mice treated with INC, miR-513c-5p inhibitor at 48 h (magnification, ×40). Scale bars = 500 μm. (E) Representative images of thrombi in each treatment group were detected by vascular ultrasound at 48 h post-operation. (F) Thrombus length & weight at 48 h post-operation in the different treatment groups (n = 15 in each group). (G) Caspase-1 mRNA level was determined by qRT-PCR in vascular tissue of each treatment group. (H) Caspase-1 & GSDMD protein levels were determined by Western blot in vascular tissue of DVT mice treated with INC, miR-513c-5p inhibitor. (I) IL-1 beta & IL-18 protein levels in vascular tissue were determined by ELISA in INC, miR-513c-5p inhibitor treated DVT mice models, respectively. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35445025), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: GSDMDC1 Antibody [NBP2-33422] - Pyroptosis & IL-1 beta release is dependent on the B. pseudomallei T3SS-3.hMDMs were infected with B. pseudomallei (MOI 300) for 3h. (A & B) Cell death induction & intracellular bacterial burden were determined at 0 & 3h p.i. Shown are the median & interquartile range of at least three independent experiments with different donors performed in technical duplicates. (C) IL-1 beta secretion was determined 3h p.i. Data are presented as median & interquartile range of four independent experiments with different donors performed in duplicates. (D) Caspase-1 & gasdermin-D processing were investigated 3h p.i. Lysates were re-probed for beta -actin. For immunoblot analysis one representative experiment of at least three with different donors is shown. (E) Growth analysis of wt & delta bsaL was performed. Shown are mean values of three independent experiments performed in technical triplicates. (*p < 0.05, **p < 0.01). n.i. (not infected), wt (wild type), b.d. (below detection), hours (h), p.i. (post infection), GSDMD (gasdermin D). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33137811), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33422_rabbit-polyclonal-gsdmdc1-antibody-310202416121947.jpg "Western Blot: GSDMDC1 Antibody [NBP2-33422] - Pyroptosis & IL-1 beta release is dependent on the B. pseudomallei T3SS-3.hMDMs were infected with B. pseudomallei (MOI 300) for 3h. (A & B) Cell death induction & intracellular bacterial burden were determined at 0 & 3h p.i. Shown are the median & interquartile range of at least three independent experiments with different donors performed in technical duplicates. (C) IL-1 beta secretion was determined 3h p.i. Data are presented as median & interquartile range of four independent experiments with different donors performed in duplicates. (D) Caspase-1 & gasdermin-D processing were investigated 3h p.i. Lysates were re-probed for beta -actin. For immunoblot analysis one representative experiment of at least three with different donors is shown. (E) Growth analysis of wt & delta bsaL was performed. Shown are mean values of three independent experiments performed in technical triplicates. (*p < 0.05, **p < 0.01). n.i. (not infected), wt (wild type), b.d. (below detection), hours (h), p.i. (post infection), GSDMD (gasdermin D). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33137811), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: GSDMDC1 Antibody [NBP2-33422] - Priming is not required for NLRP3 inflammasome activation in human monocytes in vitro. (A, B) Undifferentiated THP-1 cells (n=6 independent biological replicates) & (C, D) primary CD14+ monocytes (n=6 independent biological replicates (each point represents a different blood donor)) were left untreated or primed with LPS (1 µg/ml, 4 h) prior to treatment with nigericin (10 µM, 45 min) to activate the NLRP3 inflammasome. (A, C) IL-1 beta & IL-18 were measured by ELISA & cell death was measured by LDH assay & shown as percentage relative to total cell death, mean ± S.D., *P < 0.05; **P < 0.01; ***P < 0.001; ns (non significant) using one-way ANOVA comparing all groups. (B, D) Western blot analysis for mIL-18 (18 kDa), pro-IL-18 (24 kDa), mIL-1 beta (17 kDa), pro-IL-1 beta (34 kDa), mCaspase-1 (20 kDa), pro-Caspase-1 (45 kDa), GSDMD full length (FL, 53 kDa), GSDMD N-terminus (NT, 31 kDa), UBE2L3 (17.9 kDa), NLRP3 (113 kDa), as well as loading control beta -actin (42 kDa). Blots are representative of at least 3 independent biological experiments & in case of monocytes 3 different blood donors. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33101286), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33422_rabbit-polyclonal-gsdmdc1-antibody-310202416121939.jpg "Western Blot: GSDMDC1 Antibody [NBP2-33422] - Priming is not required for NLRP3 inflammasome activation in human monocytes in vitro. (A, B) Undifferentiated THP-1 cells (n=6 independent biological replicates) & (C, D) primary CD14+ monocytes (n=6 independent biological replicates (each point represents a different blood donor)) were left untreated or primed with LPS (1 µg/ml, 4 h) prior to treatment with nigericin (10 µM, 45 min) to activate the NLRP3 inflammasome. (A, C) IL-1 beta & IL-18 were measured by ELISA & cell death was measured by LDH assay & shown as percentage relative to total cell death, mean ± S.D., *P < 0.05; **P < 0.01; ***P < 0.001; ns (non significant) using one-way ANOVA comparing all groups. (B, D) Western blot analysis for mIL-18 (18 kDa), pro-IL-18 (24 kDa), mIL-1 beta (17 kDa), pro-IL-1 beta (34 kDa), mCaspase-1 (20 kDa), pro-Caspase-1 (45 kDa), GSDMD full length (FL, 53 kDa), GSDMD N-terminus (NT, 31 kDa), UBE2L3 (17.9 kDa), NLRP3 (113 kDa), as well as loading control beta -actin (42 kDa). Blots are representative of at least 3 independent biological experiments & in case of monocytes 3 different blood donors. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33101286), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: GSDMDC1 Antibody [NBP2-33422] - Heat-killed C. albicans (HKCA) activates NLRP3 inflammasome & induces pyroptosis in human corneal epithelial cells (HCECs). (A) The mRNA expression of NLRP3 in HCECs challenged with HKCA at an MOI of 1:500, 1:50, 1:5, 2:1, or 20:1 respectively for 4 hours was evaluated by RT-qPCR (n = 5). (B–D) The mRNA & protein expression of NLRP3 in HCECs exposed to HKCA (MOI = 20) for 0 (control), 2, 4, 8, 12, or 24 h (n = 3). (E) NLRP3 fluorescence intensity was evaluated using immunofluorescent staining for different times (12–36 h). (n = 3; Scale bar = 20 μm; magnification 400×). (F) Lactate dehydrogenase (LDH) of HCECs treated with HKCA (MOI = 20) for 24 h (n = 6). (G) The mRNA levels of ASC, CASP1, IL-1 beta , IL-18 & GSDMD in HCECs exposed to HKCA (MOI = 20) for different times (n = 3). (H,I) The protein expression of pyroptosis-related proteins (ASC, cleaved CASP1, N-GSDMD, cleaved IL-1 beta & cleaved IL-18) was examined by western blot (n = 3). CASP1: caspase-1; Clv-CASP1: cleaved CASP1; Clv-IL-1 beta : cleaved IL-1 beta ; Clv-IL-18: cleaved IL-18; N-GSDMD: cleaved p30 form of GSDMD. All values are presented as mean ± SEM. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001 vs. control group. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33422_rabbit-polyclonal-gsdmdc1-antibody-31020241612228.jpg "Western Blot: GSDMDC1 Antibody [NBP2-33422] - Heat-killed C. albicans (HKCA) activates NLRP3 inflammasome & induces pyroptosis in human corneal epithelial cells (HCECs). (A) The mRNA expression of NLRP3 in HCECs challenged with HKCA at an MOI of 1:500, 1:50, 1:5, 2:1, or 20:1 respectively for 4 hours was evaluated by RT-qPCR (n = 5). (B–D) The mRNA & protein expression of NLRP3 in HCECs exposed to HKCA (MOI = 20) for 0 (control), 2, 4, 8, 12, or 24 h (n = 3). (E) NLRP3 fluorescence intensity was evaluated using immunofluorescent staining for different times (12–36 h). (n = 3; Scale bar = 20 μm; magnification 400×). (F) Lactate dehydrogenase (LDH) of HCECs treated with HKCA (MOI = 20) for 24 h (n = 6). (G) The mRNA levels of ASC, CASP1, IL-1 beta , IL-18 & GSDMD in HCECs exposed to HKCA (MOI = 20) for different times (n = 3). (H,I) The protein expression of pyroptosis-related proteins (ASC, cleaved CASP1, N-GSDMD, cleaved IL-1 beta & cleaved IL-18) was examined by western blot (n = 3). CASP1: caspase-1; Clv-CASP1: cleaved CASP1; Clv-IL-1 beta : cleaved IL-1 beta ; Clv-IL-18: cleaved IL-18; N-GSDMD: cleaved p30 form of GSDMD. All values are presented as mean ± SEM. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001 vs. control group. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot FoxJ3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FoxJ3_AF5786_Western_Blot_5845.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
