Reactivity | Hu, Mu, BvSpecies Glossary |
Applications | WB, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Concentration | 0.5 mg/ml |
Immunogen | Synthetic peptides corresponding to HAMP(hepcidin antimicrobial peptide) The peptide sequence was selected from the N terminal of HAMP. Peptide sequence MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | HAMP |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Immunohistochemistry Paraffin (IHC-P) reported in verified customer review. |
|
Theoretical MW | 9 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Verified Customer |
IHC-P | Mouse | 04/10/2019 |
Summary
Comments
|
||||||||||
![]() Enlarge |
reviewed by:
Verified Customer |
WB | Mouse | 08/08/2018 |
Summary
|
||||||||||
![]() Enlarge |
reviewed by:
Verified Customer |
IHC-P | Bovine | 08/03/2018 |
Summary
|
||||||||||
![]() Enlarge |
reviewed by:
Verified Customer |
IHC-P | Human | 07/13/2018 |
Summary
|
||||||||||
![]() Enlarge |
reviewed by:
Verified Customer |
WB | Human | 07/11/2018 |
Summary
|
||||||||||
![]() Enlarge |
reviewed by:
Verified Customer |
WB | Bovine | 06/29/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Verified Customer 04/10/2019 |
||
Application: | IHC-P | |
Species: | Mouse |
Verified Customer 08/08/2018 |
||
Application: | WB | |
Species: | Mouse |
Verified Customer 08/03/2018 |
||
Application: | IHC-P | |
Species: | Bovine |