HHIP-Like 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: HHIP-Like 2 Antibody [NBP2-49302] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: HHIP-Like 2 Antibody [NBP2-49302] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: HHIP-Like 2 Antibody [NBP2-49302] - Staining in human testis and endometrium tissues using anti-HHIPL2 antibody. Corresponding HHIPL2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HHIP-Like 2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LCSDYCSAFHSNCHSAISLLTNDRGLQESHGRDGTRFCHLLDLPDKDYCFPNVLRNDYLNRHLGMVAQDPQGC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HHIPL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HHIP-Like 2 Recombinant Protein Antigen (NBP2-49302PEP)

Reactivity Notes

Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HHIP-Like 2 Antibody - BSA Free

• Hedgehog Interacting Protein-Like 2
• HHIP3
• HHIPL2
• HHIP-Like Protein 2
• KIAA1822L
• KIAA1822-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HHIPL2