HLA B Antibody - BSA Free

Immunohistochemistry: HLA B Antibody [NBP3-35277] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using HLA B Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: HLA B Antibody [NBP3-35277] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using HLA B Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: HLA B Antibody [NBP3-35277] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using HLA B Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: HLA B Antibody [NBP3-35277] - Western Blot analysis of various lysates using HLA B Rabbit pAb at 1:3000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HLA B Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA B (NP_005505.2).
  
  Sequence:
  MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLA-B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:1000 - 1:2000
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for HLA B Antibody - BSA Free

• ankylosing spondylitis
• AS
• B-4901
• b'DT
• Bw-22
• Bw-4
• Bw-41
• Bw-44
• Bw-45
• Bw-46
• Bw-47
• Bw-48
• Bw-50
• Bw-52
• Bw-53
• Bw-54
• Bw-55
• Bw-56
• Bw-57
• Bw-58
• Bw-60
• HLA class I histocompatibility antigen, B alpha chain
• HLA class I histocompatibility antigen, B-12 alpha chain
• HLA class I histocompatibility antigen, B-21 alpha chain
• HLA class I histocompatibility antigen, B-5 alpha chain
• HLA class I histocompatibility antigen, B-7 alpha chain
• HLAB
• HLA-B
• HLA-B27
• HLA-B73
• leukocyte antigen class I-B
• lymphocyte antigen
• major histocompatibility complex, class I, B
• MGC111087
• MHC class I antigen B*13
• MHC class I antigen B*14
• MHC class I antigen B*15
• MHC class I antigen B*18
• MHC class I antigen B*27
• MHC class I antigen B*35
• MHC class I antigen B*37
• MHC class I antigen B*38
• MHC class I antigen B*39
• MHC class I antigen B*40
• MHC class I antigen B*41
• MHC class I antigen B*42
• MHC class I antigen B*44
• MHC class I antigen B*45
• MHC class I antigen B*46
• MHC class I antigen B*47
• MHC class I antigen B*48
• MHC class I antigen B*49
• MHC class I antigen B*50
• MHC class I antigen B*51
• MHC class I antigen B*52
• MHC class I antigen B*53
• MHC class I antigen B*54
• MHC class I antigen B*55
• MHC class I antigen B*56
• MHC class I antigen B*57
• MHC class I antigen B*58
• MHC class I antigen B*59
• MHC class I antigen B*67
• MHC class I antigen B*7
• MHC class I antigen B*73
• MHC class I antigen B*78
• MHC class I antigen B*8
• MHC class I antigen B*81
• MHC class I antigen B*82
• MHC class I antigen GN00104
• MHC class I antigen HLA-B heavy chain
• MHC class I antigen SHCHA
• MHC Class I HLA heavy chain
• MHC HLA-B cell surface glycoprotein
• SPDA1

Background

HLA-B belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exon 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-B alleles have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HLA-B