HMG-CoA Reductase/HMGCR Antibody - BSA Free

Immunohistochemistry-Paraffin: HMG-CoA Reductase/HMGCR Antibody [NBP1-91996] - Staining of human gastrointestinal shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HMG-CoA Reductase/HMGCR Antibody [NBP1-91996] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: HMG-CoA Reductase/HMGCR Antibody [NBP1-91996] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: HMG-CoA Reductase/HMGCR Antibody [NBP1-91996] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HMG-CoA Reductase/HMGCR Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQG
• Predicted Species: Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HMGCR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID 27497529)
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27497529).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HMG-CoA Reductase/HMGCR Antibody - BSA Free

• 3-hydroxy-3-methylglutaryl CoA reductase (NADPH)
• 3-hydroxy-3-methylglutaryl-CoA reductase
• 3-hydroxy-3-methylglutaryl-Coenzyme A reductase
• EC 1.1.1
• EC 1.1.1.34
• HMG-CoA Reductase
• HMGCR
• Hydroxymethylglutaryl-CoA Reductase
• LDLCQ3

Background

HMG-CoA reductase is the rate-limiting enzyme for cholesterol synthesis and is regulated via a negative feedback mechanism mediated by sterols and non-sterol metabolites derived from mevalonate, the product of the reaction catalyzed by reductase. Normally in mammalian cells this enzyme is suppressed by cholesterol derived from the internalization and degradation of low density lipoprotein (LDL) via the LDL receptor. Competitive inhibitors of the reductase induce the expression of LDL receptors in the liver, which in turn increases the catabolism of plasma LDL and lowers the plasma concentration of cholesterol, an important determinant of atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HMG-CoA Reductase/HMGCR Antibody (NBP1-91996)(5)

Publications using NBP1-91996

• Hayashi K, Nakazato Y, Morito N et al. Fluvastatin is effective against thymic carcinoma Life Sci. 2019-11-28 [PMID: 31786191] (IF/IHC, Human)
• Scharinger B, Messner B, Turkcan A et al. Leoligin, the major lignan from Edelweiss, inhibits 3-hydroxy-3-methyl-glutaryl-CoA reductase and reduces cholesterol levels in ApoE-/- mice J Mol Cell Cardiol 2016-10-01 [PMID: 27497529] (ICC/IF, Mouse)
  
  Details:
  This reference used the HRP version of NB400-104.
• Gustbee E, Tryggvadottir H, Markkula A et al. Tumor-specific expression of HMG-CoA reductase in a population-based cohort of breast cancer patients. BMC Clin Pathol 2015-01-01 [PMID: 26109908] (IF/IHC, Human)
• Bengtsson E, Nerjovaj P, Wangefjord S et al. HMG-CoA reductase expression in primary colorectal cancer correlates with favourable clinicopathological characteristics and an improved clinical outcome. Diagn Pathol 2014-04-07 [PMID: 24708688]
• Bjarnadottir O, Romero Q, Bendahl PO et al. Targeting HMG-CoA reductase with statins in a window-of-opportunity breast cancer trial. Breast Cancer Res Treat 2013-04-01 [PMID: 23471651]

FAQs for HMG-CoA Reductase/HMGCR Antibody (NBP1-91996). (Showing 1 - 1 of 1 FAQs).

1. If we use this antibody for western blot, what is the predicted protein size?
   • HMGCR is a 887 amino acids long protein with a predicted size of 96.7 kDa. However, this protein undergoes extensive glycosylation and the molecular weight of the post-translationally modified protein will be more than the predicted size Uniprot Site

Bioinformatics

• Gene Symbol: HMGCR