HNF-3 beta/FoxA2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HNF-3 beta/FoxA2 Antibody [NBP2-57623] - Staining of human cell line A549 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HNF-3 beta/FoxA2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTS
• Predicted Species: Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HNF-3 beta/FoxA2 Recombinant Protein Antigen (NBP2-57623PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HNF-3 beta/FoxA2 Antibody - BSA Free

• forkhead box A2
• Forkhead box protein A2
• FoxA2
• hepatic nuclear factor-3-beta
• hepatocyte nuclear factor 3, beta
• hepatocyte nuclear factor 3-beta
• HNF3 beta
• HNF-3 beta
• HNF-3B
• HNF-3-beta
• HNF3BTCF-3B
• MGC19807
• TCF3B
• Transcription factor 3B

Background

FOXA2 encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXA2