Hyaluronan synthase 1 Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Hyaluronan synthase 1. Peptide sequence: EPAAAGAVGAGAYREVEAEDPGRLAVEALVRTRRCVCVAQRWGGKREVMY The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
HAS1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Hyaluronan synthase 1 Antibody - BSA Free
Background
Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide varietyof organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternatingglucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. HA issynthesized by membrane-bound synthase at the inner surface of the plasma membrane, and the chains are extrudedthrough pore-like structures into the extracellular space. It serves a variety of functions, including space filling,lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during woundhealing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. Changes in the serumconcentration of HA are associated with inflammatory and degenerative arthropathies such as rheumatoid arthritis. Inaddition, the interaction of HA with the leukocyte receptor CD44 is important in tissue-specific homing by leukocytes,and overexpression of HA receptors has been correlated with tumor metastasis. HAS1 is a member of the newly identifiedvertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homologyto the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and arecently described murine hyaluronan synthase. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Mu
Applications: ELISA
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for Hyaluronan synthase 1 Antibody (NBP2-85085) (0)
There are no publications for Hyaluronan synthase 1 Antibody (NBP2-85085).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hyaluronan synthase 1 Antibody (NBP2-85085) (0)
There are no reviews for Hyaluronan synthase 1 Antibody (NBP2-85085).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Hyaluronan synthase 1 Antibody (NBP2-85085) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Hyaluronan synthase 1 Products
Research Areas for Hyaluronan synthase 1 Antibody (NBP2-85085)
Find related products by research area.
|
Blogs on Hyaluronan synthase 1