Hydrogen Potassium ATPase Beta Antibody - BSA Free

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human liver.

Immunohistochemistry: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human stomach shows high expression.

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining in human stomach and pancreas tissues using anti-ATP4B antibody. Corresponding ATP4B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human colon, kidney, liver and stomach using Anti-ATP4B antibody NBP2-38674 (A) shows similar protein distribution across tissues to independent antibody NBP2-32035 (B).

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human kidney.

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human colon.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Hydrogen Potassium ATPase Beta Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP4B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Hydrogen Potassium ATPase Beta Protein (NBP2-38674PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Hydrogen Potassium ATPase Beta Antibody - BSA Free

• ATP4B
• ATP6B
• ATPase, H+/K+ exchanging, beta polypeptide
• ATPase, H+/K+ transporting, beta polypeptide
• Gastric H(+)/K(+) ATPase subunit beta
• gastric H+/K+ ATPase beta subunit
• gastric hydrogen-potassium ATPase, beta
• Hydrogen Potassium ATPase Beta
• potassium-transporting ATPase beta chain
• potassium-transporting ATPase subunit beta
• Proton pump beta chain

Background

The hydrogen/potassium ATPase, or gastric proton pump, belongs to a family of P-type cation-transporting ATPases. This family of ATPases shares a number of functional and structural similarities including the common feature of consisting of an alpha and beta subunit. Like the ubiquitous sodium/potassium ATPase, the hydrogen/potassium ATPase consists of a large transmembrane catalytic subunit, termed the alpha-subunit which contains sites for ATP binding and phosphorylation, and an associated smaller glycoprotein, termed the beta-subunit which may play a role in maintaining the structural and functional integrity of the complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP4B
• Uniprot:
  • P51164(Human)