Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen | IFI27 (NP_005523.3, 1 a.a. - 119 a.a.) full-length human protein. MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY |
Specificity | IFI27 - interferon, alpha-inducible protein 27, |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | IFI27 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Publications using H00003429-D01P | Applications | Species |
---|---|---|
Hsieh WL, Huang YH, Wang TM et al. IFI27, a novel epidermal growth factor-stabilized protein, is functionally involved in proliferation and cell cycling of human epidermal keratinocytes. Cell Prolif. 2015-02-09 [PMID: 25664647] | ||
Mclean A, Tang B, Parnell GP et al. Risk Stratification in Influenza. United States Patent Application 2015-11-12 |
Secondary Antibodies |
Isotype Controls |
Research Areas for IFI27 Antibody (H00003429-D01P)Find related products by research area.
|
COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | IFI27 |
Entrez |
|
Uniprot |
|