IL-11R alpha Antibody - BSA Free

Western Blot: IL11RA Antibody [NBP1-62351] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry-Paraffin: IL-11R alpha Antibody [NBP1-62351] - The effect of anti-human IL11Ralpha antibody combination treatment with doxorubicin on AN3CA xenograft tumour morphology in vivo. Representative photomicrographs of hematoxylin and eosin stained AN3CA subcutaneous tumour sections are shown in the top panel, arrows denote areas of tissue necrosis. AN3CA subcutaneous tumour sections were immunostained for pSTAT3, cleaved-caspase-3 (apoptosis marker) and Ki-67 (proliferation marker). Bars represent 100 um (H&E), 50 um (pSTAT3) and 200 um (caspase-3, Ki-67). Insets are negative controls. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/15187) licensed under a CC-BY license.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

IL-11R alpha Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to IL11RA(interleukin 11 receptor, alpha) The peptide sequence was selected from the middle region of IL11RA. Peptide sequence FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: alpha.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL11RA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunohistochemistry paraffin reported in scientific literature (PMID 28186993).
• Theoretical MW: 43 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28186993).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IL-11R alpha Antibody - BSA Free

• AI314697
• GP130
• IL-11 R alpha
• IL11R alpha
• IL11RA
• IL-11Ra
• Il11ra2
• NR1

Background

Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. IL11RA is the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain.Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. This gene encodes the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain. Alternative splicing has been observed at this locus and two variants, each encoding a distinct isoform, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IL-11R alpha Antibody (NBP1-62351)(3)

Publications using NBP1-62351

• Milara J, Roger I, Montero P et al. Targeting IL-11 system as a treatment of pulmonary arterial hypertension Pharmacological research 2023-11-01 [PMID: 37949331]
• J Milara, I Roger, P Montero, E Artigues, J Escrivá, J Cortijo IL-11 system participates in pulmonary artery remodeling and hypertension in pulmonary fibrosis Respiratory Research, 2022-11-15;23(1):313. 2022-11-15 [PMID: 36376885] (Mouse, Immunohistochemistry-Paraffin)
• Winship A, Van Sinderen M, Rainczuk K, Dimitriadis E. Therapeutically blocking Interleukin-11 Receptor-a enhances doxorubicin cytotoxicity in high grade type I endometrioid tumours. Oncotarget 2017-04-04 [PMID: 28186993] (IHC-P, Mouse)

Bioinformatics

• Gene Symbol: IL11RA
• Entrez:
  • 3590(Human)
• Uniprot:
  • Q14626()