IL-13R alpha 2 Antibody - BSA Free

Western Blot: IL13 receptor alpha 2 Antibody [NBP1-69687] - This Anti-IL13RA2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

IL-13R alpha 2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to IL13RA2(interleukin 13 receptor, alpha 2) The peptide sequence was selected from the middle region of IL13RA2. Peptide sequence GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: alpha-2.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL13RA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IL-13R alpha 2 Antibody - BSA Free

• cancer/testis antigen 19
• CD213a2 antigen
• CD213a2
• CT19
• IL-13 R alpha 2
• IL-13 receptor subunit alpha-2
• IL13BP
• IL13R alpha 2
• IL-13R subunit alpha-2
• IL13R
• IL-13R
• IL13RA2
• IL-13Ra2
• IL-13R-alpha-2
• interleukin 13 binding protein
• interleukin 13 receptor alpha 2 chain
• interleukin 13 receptor, alpha 2
• interleukin-13 receptor subunit alpha-2
• Interleukin-13-binding protein

Background

IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL13RA2
• Uniprot:
  • Q14627()