Recombinant Human IL-23A/IL-23 P19 Protein

Product Discontinued

Recombinant Human IL-23A/IL-23 P19 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-189 of Human IL23A full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: IL23A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 47.1 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IL-23A/IL-23 P19 Protein

• IL-23 p19/IL-12 p40
• IL23
• IL-23
• IL-23A
• IL-23-A
• IL-23p19
• IL-23p19/IL-12p40
• IL23P19P19
• interleukin 23 p19 subunit
• interleukin 23, alpha subunit p19
• interleukin-23 subunit alpha
• Interleukin-23 subunit p19
• JKA3 induced upon T-cell activation
• MGC79388
• SGRF
• SGRFIL-23 subunit alpha

Background

This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for IL-23A/IL-23 P19 Recombinant Protein (H00051561-P01)(1)

Publication using H00051561-P01

• Wang M, Zhong D, Zheng Y et al. Damage effect of interleukin (IL)-23 on oxygen-glucose-deprived cells of the neurovascular unit via IL-23 receptor. Neuroscience. 2015-01-16 [PMID: 25600958]

Bioinformatics

• Gene Symbol: IL23A