Integrin alpha 6/CD49f Antibody - BSA Free

Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining in human placenta and liver tissues . Corresponding ITGA6 RNA-seq data are presented for the same tissues.

Western Blot: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Analysis in human cell lines A-431 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining of human kidney shows moderate membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining of human rectum shows strong membranous positivity in glandular cells.

Simple Western: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Simple Western lane view shows a specific band for ITGA6 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.

Simple Western: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Electropherogram image(s) of corresponding Simple Western lane view. Integrin alpha 6/CD49f antibody was used at 1:50 dilution on RT-4 and U-251MG sp lysates(s).

• Reactivity: Hu, Mu
• Applications: WB, Simple Western, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Integrin alpha 6/CD49f Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITGA6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation Reported in scientific literature (PMID: 23888051)
  • Simple Western 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG sp, separated by Size, antibody dilution of 1:50, apparent MW was 168 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Theoretical MW: 127 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Integrin alpha 6/CD49f Protein (NBP1-85747PEP)

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 23888051). Rat (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Integrin alpha 6/CD49f Antibody - BSA Free

• CD49 antigen-like family member F
• CD49f antigen
• CD49f
• DKFZp686J01244
• FLJ18737
• Integrin alpha 6
• integrin alpha-6
• integrin alpha6B
• integrin, alpha 6
• ITGA6
• ITGA6B
• Platelet gpl
• VLA-6

Background

The ITGA6 protein product is the integrin alpha chain alpha 6. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. For example, alpha 6 may combine with beta 4 in the integrin referred to as TSP180, or with beta 1 in the integrin VLA-6. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Integrin alpha 6/CD49f Antibody (NBP1-85747)(8)

Publications using NBP1-85747

• Chalmers FE, Dusold JE, Shaik JA et al. Targeted deletion of TGF beta1 in basal keratinocytes causes profound defects in stratified squamous epithelia and aberrant melanocyte migration Developmental biology 2022-02-25 [PMID: 35227671]
• Barbar L, Jain T, Zimmer M et al. CD49f Is a Novel Marker of Functional and Reactive Human iPSC-Derived Astrocytes Neuron 2020-05-22 [PMID: 32485136]
• Crestani M, Kakogiannos N, Iannelli F et al. SP2G: an imaging and analysis pipeline revealing the inter and intra-patient migratory diversity of glioblastoma bioRxiv 2023-02-24 (WB)
• Hooks KB, Audoux J, Fazli H et al. New insights into diagnosis and therapeutic options for proliferative hepatoblastoma Hepatology. 2017-11-20 [PMID: 29152775] (IHC-P, Human)
• Wang Y, Huang Z, Nayak PS et al. Strain-induced Differentiation of Fetal Type II Epithelial Cells Is Mediated via Integrin alpha6beta1-ADAM17/TACE Signaling Pathway. J Biol Chem 2013-07-25 [PMID: 23888051] (IP, WB, Mouse)
• Tra WM, Tuk B, van Neck JW et al. Tissue-engineered mucosa is a suitable model to quantify the acute biological effects of ionizing radiation. Int J Oral Maxillofac Surg 2013-04-11 [PMID: 23583647] (IF/IHC, Human)
• Sukhdeo K, Paramban RI, Vidal JG et al. Multiplex Flow Cytometry Barcoding and Antibody Arrays Identify Surface Antigen Profiles of Primary and Metastatic Colon Cancer Cell Lines. PLoS One 2013-01-01 [PMID: 23308131]
• Kielosto M, Nummela P, Jarvinen K et al. Identification of integrins alpha6 and beta7 as c-Jun- and transformation-relevant genes in highly invasive fibrosarcoma cells. Int J Cancer. 2009-09-01 [PMID: 19405119]

Bioinformatics

• Gene Symbol: ITGA6
• Entrez:
  • 3655(Human)
• Uniprot:
  • P23229()