Irisin/FNDC5 Antibody - BSA Free

Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Specific positive staining can be observed in a subpopulation of mouse gastric mucosa cells. Green is FNDC5. Image from verified customer review.

Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human skeletal muscle shows granular cytoplasmic positivity in myocytes.

Western Blot: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of Irisin/FNDC5 expression levels detected by Western blot in Normal Human Keratinocytes (HaCat) and Larynx Epidermoid Carcinoma 2 (HEp-2) (A). The mean value of the densitometric optical analysis of the 3 repeats of Western blot detecting irisin expression levels (B). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35053200/) licensed under a CC-BY license.

Comparison of irisin expression levels detected by Western blot in Normal Human Keratinocytes (HaCat) and Larynx Epidermoid Carcinoma 2 (HEp-2) (A). The mean value of the densitometric optical analysis of the 3 repeats of Western blot detecting irisin expression levels (B).

Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression using immunohistochemistry (IHC; positive reactions—brown cell cytoplasm) in control tissue (A) & at different grades of malignancy (G) of breast cancer (BC; (B)—G1; (C)—G2, in apical parts of cells; (D)—G3) with Ki-67 (E) & PGC-1 alpha (F); magnification x200. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35408891), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Positive immunohistochemical (IHC) reactions (brown color) indicating strong irisin expression in the apical parts of cancer cells & vesicles; magnification x400. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35408891), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression using immunohistochemistry (IHC; positive reactions—brown cell cytoplasm) in control tissue (A) & at different grades of malignancy (G) of breast cancer (BC; (B)—G1; (C)—G2, in apical parts of cells; (D)—G3) with Ki-67 (E) & PGC-1 alpha (F); magnification x200. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35408891), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression using immunohistochemistry (IHC; positive reactions—brown cell cytoplasm) in control tissue (A) & at different grades of malignancy (G) of breast cancer (BC; (B)—G1; (C)—G2, in apical parts of cells; (D)—G3) with Ki-67 (E) & PGC-1 alpha (F); magnification x200. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35408891), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression using immunohistochemistry (IHC; positive reactions—brown cell cytoplasm) in control tissue (A) & at different grades of malignancy (G) of breast cancer (BC; (B)—G1; (C)—G2, in apical parts of cells; (D)—G3) with Ki-67 (E) & PGC-1 alpha (F); magnification x200. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35408891), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression using immunohistochemistry (IHC; positive reactions—brown cell cytoplasm) in control tissue (A) & at different grades of malignancy (G) of breast cancer (BC; (B)—G1; (C)—G2, in apical parts of cells; (D)—G3) with Ki-67 (E) & PGC-1 alpha (F); magnification x200. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35408891), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression levels detected by Western blot in Normal Human Keratinocytes (HaCat) & Larynx Epidermoid Carcinoma 2 (HEp-2) (A). The mean value of the densitometric optical analysis of the 3 repeats of Western blot detecting irisin expression levels (B). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35053200), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression using immunohistochemistry (IHC; positive reactions—brown cell cytoplasm) in control tissue (A) & at different grades of malignancy (G) of breast cancer (BC; (B)—G1; (C)—G2, in apical parts of cells; (D)—G3) with Ki-67 (E) & PGC-1 alpha (F); magnification x200. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35408891), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Irisin/FNDC5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR
• Predicted Species: Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FNDC5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunofluorescence Reported in scientific literature (PMID:31614634).
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Irisin/FNDC5 Protein (NBP2-14024PEP)

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Irisin/FNDC5 Antibody - BSA Free

• fibronectin type III domain containing 5
• fibronectin type III domain-containing protein 5
• FNDC5
• FRCP2
• FRCP2Fibronectin type III repeat-containing protein 2
• Irisin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Irisin/FNDC5 Antibody (NBP2-14024)(7)

Publications using NBP2-14024

• Cebulski K, Piotrowska A, Kmiecik A et al. The Role of Irisin/FNDC5 Expression and Its Serum Level in Breast Cancer International journal of molecular sciences 2023-05-11 [PMID: 37239973] (ICC/IF, IHC, Human)
• Nowi?ska K, Jab?o?ska K, Ciesielska U et al. Association of Irisin/FNDC5 with ERR? and PGC-1? Expression in NSCLC International Journal of Molecular Sciences 2022-11-17 [PMID: 36430689]
• Cebulski K, Nowinska K, Jablonska K et al. Expression of Irisin/FNDC5 in Breast Cancer International Journal of Molecular Sciences 2022-03-24 [PMID: 35408891] (IF/IHC, Human)
• Pinkowska A, Nowinska K, Ciesielska U, Podhorska-Okolow M Irisin Association with Ki-67, MCM3 and MT-I/II in Squamous Cell Carcinomas of the Larynx Biomolecules 2021-12-30 [PMID: 35053200] (IHC-P, Human)
• SLAWOMIR WOZNIAK, KATARZYNA NOWINSKA, MARIUSZ CHABOWSKI, PIOTR DZIEGIEL Significance of Irisin (FNDC5) Expression in Colorectal Cancer In Vivo 2022-01-03 [PMID: 34972713]
• Nowinska K, Jablonska K, Pawelczyk K, et al. Expression of Irisin/FNDC5 in Cancer Cells and Stromal Fibroblasts of Non-small Cell Lung Cancer. Cancers (Basel) 2019-10-11 [PMID: 31614634] (IF, IF, Human)
• Komolka K, Albrecht E, Schering L et al. Locus Characterization and Gene Expression of Bovine FNDC5: Is the Myokine Irisin Relevant in Cattle?. PLoS One 2014-01-01 [PMID: 24498244]

Review for Irisin/FNDC5 Antibody (NBP2-14024) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer IHC-P Mouse 01/23/2019

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Stomach tissue
• Species: Mouse
• Lot: A96720

Bioinformatics

• Gene Symbol: FNDC5