KLF5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KLF5 Antibody [NBP1-88508] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: KLF5 Antibody [NBP1-88508] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: KLF5 Antibody [NBP1-88508] - Staining of human stomach shows strong nuclear and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: KLF5 Antibody [NBP1-88508] - Staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: KLF5 Antibody [NBP1-88508] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KLF5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTK
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLF5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KLF5 Protein (NBP1-88508PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26212907).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KLF5 Antibody - BSA Free

• Basic transcription element-binding protein 2
• BTEB2
• BTE-binding protein 2
• CKLFGC-box-binding protein 2
• Colon krueppel-like factor
• colon kruppel-like factor
• GC box binding protein 2
• IKLFbasic transcription element binding protein 2
• Intestinal-enriched krueppel-like factor
• intestinal-enriched kruppel-like factor
• KLF5
• Krueppel-like factor 5
• Kruppel-like factor 5 (intestinal)
• Transcription factor BTEB2

Background

KLF5 encodes a member of the Kruppel-like factor subfamily of zinc finger proteins. Since the protein localizes to the nucleus and binds the epidermal growth factor response element, it is thought to be a transcription factor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KLF5 Antibody (NBP1-88508)(2)

Publications using NBP1-88508

• Muta K, Nakazawa Y, Obata Y et al. An inhibitor of KrUppel-like factor 5 suppresses peritoneal fibrosis in mice Peritoneal dialysis international : journal of the International Society for Peritoneal Dialysis 2021-02-01 [PMID: 33522431]
• Chen WC, Lin HH, Tang MJ et al. Matrix-Stiffness-Regulated Inverse Expression of Kruppel-Like Factor 5 and Kruppel-Like Factor 4 in the Pathogenesis of Renal Fibrosis Am J Pathol. 2015-07-23 [PMID: 26212907] (IHC-P, ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: KLF5