Klotho Antibody - BSA Free

Western Blot: Klotho Antibody [NBP1-55097] - Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Klotho Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to KL(klotho) The peptide sequence was selected from the n terminal of KL (BAA24941). Peptide sequence FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 60 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Klotho Antibody - BSA Free

• EC 3.2.1
• EC 3.2.1.31
• KL
• Klotho

Background

This gene encodes a type-I membrane protein that is related to beta-glucosidases. Reduced production of this protein has been observed in patients with chronic renal failure (CRF), and this may be one of the factors underlying the degenerative processes (

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Klotho Antibody (NBP1-55097)(1)

Publication using NBP1-55097

• Chen,D. J. Biol. Chem. 282 (46), 33776-33787. 2007-01-01 [PMID: 17893151]

FAQs for Klotho Antibody (NBP1-55097). (Showing 1 - 1 of 1 FAQ).

1. I study physiology (PhD) and I need a klotho kit.
   • A list of our klotho products can be found here. I am not entirely sure what you are looking for as I don't have your complete message for some reason. Can you please clarify what you are looking for?

Bioinformatics

• Gene Symbol: KL
• Entrez:
  • 9365(Human)
• Uniprot:
  • Q9UEF7()