Laminin beta 1 Antibody (6I9T4)

Images

 
Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Western blot analysis of extracts of Rat lung, using Laminin beta 1 Rabbit mAb (NBP3-16392) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG ...read more
Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Western blot analysis of extracts of Mouse heart, using Laminin beta 1 Rabbit mAb (NBP3-16392) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit ...read more
Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Western blot analysis of extracts of HepG2 cells, using Laminin beta 1 Rabbit mAb (NBP3-16392) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit ...read more
Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Confocal imaging of NIH/3T3 cells using Laminin beta 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG ...read more
Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Confocal imaging of Hep G2 cells using Laminin beta 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG ...read more
Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Confocal imaging of C6 cells using Laminin beta 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . ...read more
Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [Laminin beta 1] - Confocal imaging of NIH/3T3 cells using Laminin beta 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit ...read more
Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [Laminin beta 1] - Confocal imaging of C6 cells using Laminin beta 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG ...read more
Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [Laminin beta 1] - Confocal imaging of Hep G2 cells using Laminin beta 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clone
6I9T4
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Laminin beta 1 Antibody (6I9T4) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1687-1786 of human Laminin beta 1 (P07942). KKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
LAMB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Laminin beta 1 Antibody (6I9T4)

  • CLM
  • cutis laxa with marfanoid phenotype
  • Laminin B1 chain
  • laminin subunit beta-1
  • laminin, beta 1
  • Laminin-1 subunit beta
  • Laminin-10 subunit beta
  • Laminin-12 subunit beta
  • Laminin-2 subunit beta
  • Laminin-6 subunit beta
  • Laminin-8 subunit beta
  • MGC142015

Background

Laminins are essential and abundant structural non-collagenous glycoproteins localizing to basement membranes. Basement membranes (cell-associated extracellular matrices (ECMs)) are polymers of Laminins with stabilizing type IV collagen networks, nidogen and several proteoglycans. Basement membranes are found under epithelial layers, around the endothelium of blood vessels and surrounding muscle, peripheral nerve and fat cells. Formation of basement membranes influences cell proliferation, phenotype, migration, gene expression and tissue architecture. Each Laminin is a heterotrimer of alpha, beta and gamma chain subunits that undergoes cell-secretion and incorporation into the ECM. Laminins can self-assemble and bind to other matrix macromolecules, and have unique and shared cell interactions mediated by Integrins, dystroglycan and cognate Laminin receptors. The human Laminin gamma-1 gene maps to chromosome 1q31 and is ubiquitously expressed in tissues that produce basement membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-44751
Species: Bv, Hu, Mu
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-26612
Species: Hu
Applications: IP (-), WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB300-144
Species: ChHa, Hu, In, Ma, Mu, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: IHC, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-41306
Species: Hu, Mu, Rt
Applications: WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
PP-H8132-00
Species: Hu
Applications: IHC, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for Laminin beta 1 Antibody (NBP3-16392) (0)

There are no publications for Laminin beta 1 Antibody (NBP3-16392).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin beta 1 Antibody (NBP3-16392) (0)

There are no reviews for Laminin beta 1 Antibody (NBP3-16392). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Laminin beta 1 Antibody (NBP3-16392) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laminin beta 1 Antibody (6I9T4) and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMB1