LATS1 Antibody - BSA Free

Western Blot: LATS1 Antibody [NBP1-86860] - Analysis in human cell line HELA.

Immunohistochemistry-Paraffin: LATS1 Antibody [NBP1-86860] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: LATS1 Antibody [NBP1-86860] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: LATS1 Antibody [NBP1-86860] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: LATS1 Antibody [NBP1-86860] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscles and glandular cells.

• Reactivity: Hu, Rt, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LATS1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGYPPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRP
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LATS1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 29317530). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LATS1 Protein (NBP1-86860PEP)

Reactivity Notes

Rat reactivity reported in the scientific literature (PMID: 29317530).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LATS1 Antibody - BSA Free

• EC 2.7.11
• h-warts
• Large tumor suppressor homolog 1
• LATS (large tumor suppressor, Drosophila) homolog 1
• LATS, large tumor suppressor, homolog 1 (Drosophila)
• serine/threonine-protein kinase LATS1
• WARTS protein kinase
• WARTSEC 2.7.11.1
• wts

Background

LATS1 is encoded by this gene is a putative serine/threonine kinase that localizes to the mitotic apparatus and complexes with cell cycle controller CDC2 kinase in early mitosis. The protein is phosphorylated in a cell-cycle dependent manner, with late prophase phosphorylation remaining through metaphase. The N-terminal region of the protein binds CDC2 to form a complex showing reduced H1 histone kinase activity, indicating a role as a negative regulator of CDC2/cyclin A. In addition, the C-terminal kinase domain binds to its own N-terminal region, suggesting potential negative regulation through interference with complex formation via intramolecular binding. Biochemical and genetic data suggest a role as a tumor suppressor. This is supported by studies in knockout mice showing development of soft-tissue sarcomas, ovarian stromal cell tumors and a high sensitivity to carcinogenic treatments.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LATS1 Antibody (NBP1-86860)(1)

Publication using NBP1-86860

• Wigerius M, Quinn D, Diab A et al. The polarity protein Angiomotin p130 controls dendritic spine maturation J. Cell Biol. 2018-02-05 [PMID: 29317530] (WB, Rat)

Bioinformatics

• Gene Symbol: LATS1