LHX6 Antibody

Immunohistochemistry-Paraffin: LHX6 Antibody [NBP2-14192] Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Discontinued

LHX6 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVH LKADMDGPLSNRGEKVIL
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LHX6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LHX6 Antibody

• LHX6.1LIM homeobox protein 6
• LIM homeobox 6
• LIM homeodomain protein 6.1
• LIM/homeobox protein Lhx6
• LIM/homeobox protein Lhx6.1
• MGC119542
• MGC119544
• MGC119545

Background

LHX6 is a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LHX6