Calretinin Antibody - BSA Free

Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining in human testis and skeletal muscle tissues using NBP1-88220 antibody. Corresponding CALB2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining in human testis and skeletal muscle tissues using NBP1-88220 antibody. Corresponding CALB2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human cerebellum, skeletal muscle, stomach and testis using Anti-CALB2 antibody NBP1-88220 (A) shows similar protein distribution across tissues to independent antibody NBP1-88221 (B).

Western Blot: Calretinin Antibody [NBP1-88220] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: Calretinin Antibody [NBP1-88220] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Western Blot: Calretinin Antibody [NBP1-88220] - Analysis in human cerebral cortex tissue.

Western Blot: Calretinin Antibody [NBP1-88220] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in cells in granular layer.

Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human testis shows strong cytoplasmic and nuclear positivity in Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Calretinin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKY
• Marker: Mesothelial Cell Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CALB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Calretinin Protein (NBP1-88220PEP)

  Loading...

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Calretinin Antibody - BSA Free

• 29 kDa calbindin
• CAB29
• CAL2
• CALB2
• calbindin 2
• calbindin 2, (29kD, calretinin)
• calbindin 2, 29kDa (calretinin)
• calbindin D29K
• Calretinin
• CR

Background

Calretinin (CAB29, calbindin 2) is a calcium binding protein that belongs to calbindin family. It is mainly found in neuronal tissue, high expressed in auditory neurons. It has been implicated in as a calcium buffer, calcium sensor, and as a regulator of apoptosis (1). Calretinin is considered as a specific marker of mesothelllal cells; it is the only marker that has the utility in distinguishing between sarcomatoid mesotheliomas and sarcomatoid renal cell carcinomas (2). It is widely used in the panel of makers for distinguishing mesothlioma from adenocarcinoma. Along with calretinin, the panel includes E-cadherin, CEA, and cytokeratin 5/6 (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Calretinin Antibody (NBP1-88220)(1)

Publication using NBP1-88220

• Mulder J, Bjorling E, Jonasson K et al. Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics. Mol Cell Proteomics 2009-07-01 [PMID: 19351664]

Review for Calretinin Antibody (NBP1-88220) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Verified Customer IHC-P Rat 01/07/2019

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Brain tissue
• Species: Rat
• Lot: A83215

Comments

• Comments: Rat brain tissue - Alcohol fixed-paraffin embedded

Bioinformatics

• Gene Symbol: CALB2