LLC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: LLC1 Antibody [NBP2-31709] - Staining of human placenta shows low expression as expected.

Immunohistochemistry-Paraffin: LLC1 Antibody [NBP2-31709] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: LLC1 Antibody [NBP2-31709] - C20orf85 Antibody [NBP2-31709] - Staining in human fallopian tube and placenta tissues using anti-C20orf85 antibody. Corresponding C20orf85 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LLC1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAQKPLSTAAAERMNLVGQDEIWKYRLKAESEARQNWPQNWGFLTTPFEELIKCEEDLPTPKPKIELPERF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C20ORF85
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LLC1 Recombinant Protein Antigen (NBP2-31709PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LLC1 Antibody - BSA Free

• bA196N14.1
• chromosome 20 open reading frame 85
• hypothetical protein LOC128602
• LLC1
• low in lung cancer 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C20ORF85
• Uniprot:
  • Q9H1P6(Human)