Western Blot: LPCAT3 Antibody [NBP3-04752] - nalysis of lysates from HepG2 cells, using LPCAT3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug ...read more
IHC-P-NBP3-04752-LPCAT3 Antibody - Azide and BSA Free- Analysis of LPCAT3 in paraffin-embedded rat kidney tissue using LPCAT3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed ...read more
Immunohistochemistry: LPCAT3 Antibody - Azide and BSA Free [LPCAT3] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using LPCAT3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure ...read more
Immunohistochemistry: LPCAT3 Antibody - Azide and BSA Free [LPCAT3] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using LPCAT3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure ...read more
Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human LPCAT3 (NP_005759.4). GPQFSMNHYMKLVQGELIDIPGKIPNSIIPALKRLSLGLFYLVGYTLLSPHITEDYLLTEDYDNHPFWFRCMYMLIWGKFVLYKYVTCWLVTEGVCILTGL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPCAT3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Immunohistochemistry 1:50 - 1:200
Immunohistochemistry-Paraffin 1:50 -1:200
Western Blot 1:500 - 1:1000
Theoretical MW
56 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP3-04752 in the following applications:
Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC) (LPCAT activity). Catalyzes also the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Has also weak lysophosphatidylethanolamine acyltransferase activity (LPEAT activity). Favors polyunsaturated fatty acyl-CoAs as acyl donors compared to saturated fatty acyl-CoAs. Seems to be the major enzyme contributing to LPCAT activity in the liver. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for LPCAT3 Antibody (NBP3-04752)(2)
We have publications tested in 1 confirmed species: Human.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our LPCAT3 Antibody - Azide and BSA Free and receive a gift card or discount.