M-Ras/R-Ras3 Antibody

Immunohistochemistry-Paraffin: M-Ras/R-Ras3 Antibody [NBP1-81039] - Staining of human prostate shows moderate cytoplasmic positivity in glandular and smooth muscle cells.

Immunohistochemistry-Paraffin: M-Ras/R-Ras3 Antibody [NBP1-81039] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: M-Ras/R-Ras3 Antibody [NBP1-81039] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: M-Ras/R-Ras3 Antibody [NBP1-81039] - Staining of human endometrium shows strong membranous positivity in glandular cells.

Product Discontinued

M-Ras/R-Ras3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRAS
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:1000-1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for M-Ras/R-Ras3 Antibody

• FLJ42964
• MRas
• M-Ras
• muscle and microspikes RAS
• muscle RAS oncogene homolog
• ras-related protein M-Ras
• Ras-related protein R-Ras3
• R-RAS3
• RRAS3M-RAs

Background

MRAS (muscle RAS oncogene homolog) belongs to the Ras family of small GTPases and could play a role as a signal transducer. MRAS is known to have interactions with MLLT4, RASSF5, RALGDS, BRAF and PIK3CA. This protein is currently being studied for research on the following diseases and disorders: neuronitis, Parkinson's disease, gigantism and Noonan syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRAS
• Entrez:
  • 22808(Human)
• Uniprot:
  • O14807()
  • O14807()
  • O14807()
  • O14807()