MafB Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MafB Antibody [NBP1-81342] - Staining of human cell line hTCEpi shows localization to nucleus & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342] - Staining of human parathyroid gland shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342] - Staining of human kidney shows moderate to strong nuclear positivity in podocytes.

Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342] - Staining of human lung shows moderate to strong nuclear positivity in macrophages.

Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342] - Staining of human pancreas shows moderate to strong nuclear positivity in islets of Langerhans.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MafB Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAFB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Validated from a verified customer review
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
• Control Peptide:

  MafB Protein (NBP1-81342PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25053437).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MafB Antibody - BSA Free

• Kreisler (mouse) maf-related leucine zipper homolog
• Kreisler maf-related leucine zipper homolog
• KRML
• KRMLMAFB/Kreisler basic region/leucine zipper transcription factor
• MafB
• Maf-B
• MGC43127
• transcription factor MafB
• v-maf musculoaponeurotic fibrosarcoma oncogene homolog B (avian)
• V-maf musculoaponeurotic fibrosarcoma oncogene homolog B

Background

MAFB is encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MafB Antibody (NBP1-81342)(6)

Publications using NBP1-81342

• Goudot C, Coillard A, Villani A et al. Aryl Hydrocarbon Receptor Controls Monocyte Differentiation into Dendritic Cells versus Macrophages. Immunity 2017-09-19 [PMID: 28930664] (WB, Human)
• Conrad E, Dai C, Spaeth J et al. The MAFB transcription factor impacts islet a-cell function in rodents and represents a unique signature of primate islet b-cells. Am. J. Physiol. Endocrinol. Metab. 2016-01-01 [PMID: 26554594] (IF/IHC, Human)
• Brunskill EW, Park JS, Chung E et al. Single cell dissection of early kidney development: multilineage priming. Development 2014-08-01 [PMID: 25053437] (IF/IHC, Mouse)
• Pasquali L, Gaulton KJ, Rodriguez-Segui SA et al. Pancreatic islet enhancer clusters enriched in type 2 diabetes risk-associated variants. Nat Genet 2014-02-01 [PMID: 24413736]
• Digby JLM, Przepiorski A, Davidson AJ, Sander V Modeling acute kidney injury in kidney organoids with cisplatin bioRxiv 2019-12-23 (IHC-P, Human)
• Digby Jlm, Vanichapol T, Przepiorski A et Al. Evaluation of cisplatin-induced injury in human kidney organoids Am. J. Physiol. Renal Physiol. 2020-04-01 [PMID: 32150447]

Review for MafB Antibody (NBP1-81342) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 06/07/2016

Summary

• Application: Western Blot
• Sample Tested: Whole cell lysate
• Species: Human

Bioinformatics

• Gene Symbol: MAFB