![Western Blot: Matrin 3 Antibody [NBP1-57359] - Antibody Titration: 1. 25 ug/ml Positive control: Jurkat cell lysate MATR3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.](http://images.novusbio.com/fullsize/Matrin-3-Antibody-Western-Blot-NBP1-57359-img0007.jpg "Western Blot: Matrin 3 Antibody [NBP1-57359] - Antibody Titration: 1. 25 ug/ml Positive control: Jurkat cell lysate MATR3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to MATR3 (matrin 3) The peptide sequence was selected from the N terminal of MATR3.
Peptide sequence MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MATR3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
![Western Blot Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets-1_AF7284_Western_Blot_11854.jpg)
![Immunohistochemistry Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets1_AF7284_Immunohistochemistry_22698.jpg)
![Immunohistochemistry MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Immunohistochemistry_19508.jpg)
![Western Blot MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Western_Blot_19525.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Matrin 3 Antibody (NBP1-57359)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: Matrin 3 Antibody [NBP1-57359] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.](http://images.novusbio.com/fullsize/Matrin-3-Antibody-Immunohistochemistry-NBP1-57359-img0006.jpg "Immunohistochemistry: Matrin 3 Antibody [NBP1-57359] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.")
![Western Blot: Matrin 3 Antibody [NBP1-57359] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml](http://images.novusbio.com/fullsize/Matrin-3-Antibody-Western-Blot-NBP1-57359-img0001.jpg "Western Blot: Matrin 3 Antibody [NBP1-57359] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml")
![Immunohistochemistry-Paraffin: Matrin 3 Antibody [NBP1-57359] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://images.novusbio.com/fullsize/Matrin-3-Antibody-Immunohistochemistry-Paraffin-NBP1-57359-img0004.jpg "Immunohistochemistry-Paraffin: Matrin 3 Antibody [NBP1-57359] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.")
![Immunohistochemistry: Matrin 3 Antibody [NBP1-57359] - Human Heart Cellular data: Myocardial cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.](http://images.novusbio.com/fullsize/Matrin-3-Antibody-Immunohistochemistry-NBP1-57359-img0005.jpg "Immunohistochemistry: Matrin 3 Antibody [NBP1-57359] - Human Heart Cellular data: Myocardial cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.")
![Western Blot IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGFBPrp1_AF1334_Western_Blot_16698.jpg)
![Immunohistochemistry IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGFBPrp1_AF1334_Immunohistochemistry_17204.jpg)
![Western Blot FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Western_Blot_5399.jpg)
![Simple Western FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Simple_Western_16755.jpg)
![Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Immunohistochemistry_6823.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")