MCM6 Antibody - BSA Free

Western Blot: MCM6 Antibody [NBP1-82642] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: MCM6 Antibody [NBP1-82642] - Staining of human cell line U-2 OS shows positivity in nuclei but not nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-82642] - Staining in human lymph node and liver tissues using anti-MCM6 antibody. Corresponding MCM6 RNA-seq data are presented for the same tissues.

Western Blot: MCM6 Antibody [NBP1-82642] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MCM6 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-82642] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-82642] - Staining of human lymph node shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MCM6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLACCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MCM6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 24658369). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MCM6 Protein (NBP1-82642PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MCM6 Antibody - BSA Free

• DNA replication licensing factor MCM6
• EC 3.6.4.12
• MCG40308
• MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S.cerevisiae)
• MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe)
• minichromosome maintenance complex component 6
• minichromosome maintenance deficient (mis5, S. pombe) 6
• minichromosome maintenance deficient 6 homolog (S. cerevisiae)
• minichromosome maintenance deficient 6 homolog
• MIS5 homolog
• Mis5
• p105MCM

Background

MCM6 is encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MCM6 Antibody (NBP1-82642)(2)

Publications using NBP1-82642

• Panneerselvam J, Pickering A, Han B et al. Basal level of FANCD2 monoubiquitination is required for the maintenance of a sufficient number of licensed-replication origins to fire at a normal rate. Oncotarget 2014-07-15 [PMID: 24658369] (WB, Human)
  
  Details:
  MCM6 antibody used for WB on several experiments involving CRL-1790 and HEK293T cells.
• Kadara H, Behrens C, Yuan P et al. A five-gene and corresponding protein signature for stage-I lung adenocarcinoma prognosis Clin Cancer Res 2011-03-15 [PMID: 21163870] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: MCM6