MEOX 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: MEOX 2 Antibody [NBP2-30647] - Analysis in human placenta and prostate tissues using antibody. Corresponding MEOX2 RNA-seq data are presented for the same tissues.

Western Blot: MEOX 2 Antibody [NBP2-30647] - Analysis in control (vector only transfected HEK293T lysate) and MEOX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: MEOX 2 Antibody [NBP2-30647] - Staining of human placenta shows strong nuclear positivity in endothelial cells.

Immunohistochemistry-Paraffin: MEOX 2 Antibody [NBP2-30647] - Staining of human liver shows no positivity in hepatocytes as expected

Immunohistochemistry-Paraffin: MEOX 2 Antibody [NBP2-30647] - Staining of human cerebral cortex shows no positivity in neurons as expected

Immunohistochemistry-Paraffin: MEOX 2 Antibody [NBP2-30647] - Staining of human prostate shows no positivity in glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MEOX 2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKR
• Marker: Mesoderm Marker
• Predicted Species: Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MEOX2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 -1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MEOX 2 Protein (NBP2-30647PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MEOX 2 Antibody - BSA Free

• growth arrest-specific homeo box
• Growth arrest-specific homeobox
• homeobox protein MOX-2
• mesenchyme homeo box 2 (growth arrest-specific homeo box)
• mesenchyme homeobox 2GAX
• MOX2mesenchyme homeobox 2 (growth arrest-specific homeo box)

Background

MEOX 2 encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MEOX 2 Antibody (NBP2-30647)(1)

Publication using NBP2-30647

• Odemaris Narvaez Del Pilar, Maria Jose Gacha Garay, Jichao Chen Three-axis classification of mouse lung mesenchymal cells reveals two populations of myofibroblasts. Development (Cambridge, England) 2022-04-14 [PMID: 35302583]

Bioinformatics

• Gene Symbol: MEOX2
• Uniprot:
  • P50222(Human)