MS4A6A Antibody - BSA Free

Immunohistochemistry-Paraffin: MS4A6A Antibody [NBP1-86541] - Staining of human skeletal muscle shows negative membranous positivity in myocytes.

Immunohistochemistry-Paraffin: MS4A6A Antibody [NBP1-86541] - Staining of human duodenum shows strong apical membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: MS4A6A Antibody [NBP1-86541] - Staining of human placenta shows moderate membranous and cytoplasmic positivity in trohoblastic cells.

Immunohistochemistry-Paraffin: MS4A6A Antibody [NBP1-86541] - Staining of human pancreas shows negative membranous positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MS4A6A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SFSPNFTQVTSTLLNSAYPFIGPFFVSRVSEEGRMGQRGEEDTNSLDFPPASLLCLICQEQGVNGESCSPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MS4A6A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MS4A6A Protein (NBP1-86541PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MS4A6A Antibody - BSA Free

• 4SPAN3
• CD20 antigen-like 3
• CD20L3
• CD20L3MS4A6A-polymorph
• CD20-like precusor
• CDA01
• Four-span transmembrane protein 3
• four-span transmembrane protein 3.1,4SPAN3.2
• four-span transmembrane protein 3.2
• HAIRB-iso
• membrane-spanning 4-domains subfamily A member 6A
• membrane-spanning 4-domains, subfamily A, member 6A
• MGC131944
• MGC22650
• MS4A6A
• MS4A6MST090
• MST090
• MSTP090

Background

MS4A6A (membrane-spanning 4-domains, subfamily A, member 6A) is a member of the membrane-spanning 4A gene family. MS4A6A may have a role in signal transduction. MS4A6A is currently being studied in relation to adenocarcinoma, Alzheimer's disease, esophagitis, hepatitis and hepatitis B.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MS4A6A