MTHFD2 Antibody (3C9Q8)

Western Blot: MTHFD2 Antibody (3C9Q8) [NBP3-33374] - Western blot analysis of various lysates, using MTHFD2 Rabbit mAb at 1:7000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 3C9Q8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MTHFD2 Antibody (3C9Q8) Summary

• Immunogen: Recombinant funsion protein containing a sequence corresponding to amino acids 40-250 of human MTHFD2 (NP_006627.2).
  
  Sequence:
  ISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIV
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MTHFD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:2000 - 1:8000
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for MTHFD2 Antibody (3C9Q8)

• bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase
• methenyltetrahydrofolate cyclohydrolase
• methylene tetrahydrofolate dehydrogenase (NAD+ dependent)
• methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2
• mitochondrial
• NAD-dependent methylene tetrahydrofolate dehydrogenase cyclohydrolase
• NMDMC

Background

MTHFD2 encodes a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD. Alternative splicing results in multiple transcripts encoding different isoforms. This gene has a pseudogene on chromosome 7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MTHFD2