Myeloperoxidase/MPO Antibody - BSA Free Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: GAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLR |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MPO |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:2500 - 1:5000
- Immunohistochemistry-Paraffin 1:2500 - 1:5000
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Myeloperoxidase/MPO Antibody - BSA Free
Background
FUNCTION: Part of the host defense system of polymorphonuclear leukocytes. It is responsible for microbicidal activity against a wide range of organisms. In the stimulated PMN, MPO catalyzes the production of hypohalous acids, primarily hypochlorous acid in physiologic situations, and other toxic intermediates that greatly enhance PMN microbicidal activity. MPO is an important marker for myeloid cells, from the promyelocyte stage and to the mature forms. CATALYTIC ACTIVITY: Donor + H2O2 = oxidized donor + 2 H2O. CATALYTIC ACTIVITY: Cl- + H2O2 = HOCl + 2 H2O. COFACTOR: Binds 1 calcium ion per heterodimer. COFACTOR: Binds 1 heme B (iron-protoporphyrin IX) group covalently per heterodimer. SUBUNIT: Tetramer of two light chains and two heavy chains. SUBCELLULAR LOCATION: Lysosome. ALTERNATIVE PRODUCTS: 3 named isoforms produced by alternative splicing. DISEASE: Defects in MPO are the cause of myeloperoxidase deficiency (MPD). MPD is an autosomal recessive defect that results in disseminated candidiasis. SIMILARITY: Belongs to the peroxidase family. XPO subfamily.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Mu
Applications: ELISA
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: AdBlk, IHC, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Gt, Hu, Mu, Sh
Applications: WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for Myeloperoxidase/MPO Antibody (NBP2-38922) (0)
There are no publications for Myeloperoxidase/MPO Antibody (NBP2-38922).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Myeloperoxidase/MPO Antibody (NBP2-38922) (0)
There are no reviews for Myeloperoxidase/MPO Antibody (NBP2-38922).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Myeloperoxidase/MPO Antibody (NBP2-38922) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Myeloperoxidase/MPO Products
Research Areas for Myeloperoxidase/MPO Antibody (NBP2-38922)
Find related products by research area.
|
Blogs on Myeloperoxidase/MPO