MYOM1 Antibody - BSA Free

Immunohistochemistry-Paraffin: MYOM1 Antibody [NBP2-38603] - Staining of human skeletal muscle shows cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: MYOM1 Antibody [NBP2-38603] - Analysis in human heart muscle and pancreas tissues. Corresponding MYOM1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MYOM1 Antibody [NBP2-38603] - Staining of human heart muscle, pancreas, prostate and skeletal muscle using Anti-MYOM1 antibody NBP2-38603 (A) shows similar protein distribution across tissues to independent antibody NBP1-86460 (B).

Immunohistochemistry-Paraffin: MYOM1 Antibody [NBP2-38603] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: MYOM1 Antibody [NBP2-38603] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: MYOM1 Antibody [NBP2-38603] - Staining of human prostate shows no positivity in smooth muscle cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MYOM1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYOM1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MYOM1 Protein (NBP2-38603PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (80%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MYOM1 Antibody - BSA Free

• 190 kDa connectin-associated protein
• 190 kDa titin-associated protein
• EH-myomesin
• MGC134946
• MGC134947
• myomesin (M-protein) 1 (190kD)
• myomesin 1 (skelemin) (185kD)
• myomesin 1 (skelemin) 185kDa
• myomesin 1, 185kDa
• Myomesin family member 1
• myomesin-1
• SKELEMIN

Background

The giant protein titin, together with its associated proteins, interconnects the major structure of sarcomeres, the M bands and Z discs. The C-terminal end of the titin string extends into the M line, where it binds tightly to M-band constituents of apparent molecular masses of 190 kD (myomesin 1) and 165 kD (myomesin 2). This protein, myomesin 1, like myomesin 2, titin, and other myofibrillar proteins contains structural modules with strong homology to either fibronectin type III (motif I) or immunoglobulin C2 (motif II) domains. Myomesin 1 and myomesin 2 each have a unique N-terminal region followed by 12 modules of motif I or motif II, in the arrangement II-II-I-I-I-I-I-II-II-II-II-II. The two proteins share 50% sequence identity in this repeat-containing region. The head structure formed by these 2 proteins on one end of the titin string extends into the center of the M band. The integrating structure of the sarcomere arises from muscle-specific members of the superfamily of immunoglobulin-like proteins. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYOM1
• Uniprot:
  • P52179(Human)