N4BP2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: N4BP2 Antibody [NBP1-88948] - Staining of human cell line U-2 OS shows localization to plasma membrane & centrosome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: N4BP2 Antibody [NBP1-88948] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

N4BP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FSLGLNLKEIISQRGTLENSNSPVPEFSHGIGISNADSQSTCDAERGNSEQAEMRAVTPENHESMTSIFPSAAVGLKNNNDILPNSQEEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: N4BP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  N4BP2 Protein (NBP1-88948PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for N4BP2 Antibody - BSA Free

• B3BPKIAA1413
• BCL-3-binding protein
• EC 3.-
• FLJ10680
• NEDD4 binding protein 2
• NEDD4-binding protein 2

Background

N4BP2 - Nedd4 binding protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: N4BP2