Orthogonal Strategies: Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Analysis in human colon and liver tissues using NBP1-82574 antibody. Corresponding SLC9A3 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human colon, kidney, liver and small intestine using Anti-SLC9A3 antibody NBP1-82574 (A) shows similar ...read more
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human liver shows no membranous positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human colon shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human gallbladder shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human kidney shows weak positivity in apical membrane in cells in tubules.
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.
This antibody was developed against Recombinant Protein corresponding to amino acids: DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC9A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in scientific literature (PMID: 29196502). Use in Porcine reported in scientific publication (PMID: 32738496).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for NHE3/SLC9A3 Antibody - BSA Free
isoform 3
MGC126718
NHE3
NHE3MGC126720
SLC9A3
solute carrier family 9 (sodium/hydrogen exchanger), member 3
Solute carrier family 9 member 3
Background
NHE3 is a member of the Sodium/Hydrogen exchanger family that plays a crucial role in acid-base and volume homeostasis by mediating the majority of sodium and bicarbonate reabsorption in the proximal tubule of the kidney. Two PKA consensus sites have been discovered in rat NHE3, serine 552 and serine 605. Research suggests that dopamine-induced phosphorylation of these consensus sites inhibit NHE3.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Hernandez-Gordillo V, Kassis T, Lampejo A, Choi GH Niche-inspired synthetic matrices for epithelial organoid culture bioRxiv
Zachos NC, Baetz NW, Gupta A et al. Human Rotavirus Diarrhea Is Associated with Altered Trafficking and Expression of Apical Membrane Transport Proteins bioRxiv 2019-09-26 (ICC/IF)
FAQs for NHE3/SLC9A3 Antibody (NBP1-82574). (Showing 1 - 1 of 1 FAQs).
The molecular weight of NHE3 is 92kDa but I see a band above 100 kDa. I am confused, because the size of these protein should not be greater than 100KD. Can you please help explain?
Higher than predicted molecular weight seen on WB is not uncommon if the protein is posttranslationally modified, especially glycosylated, and such is the case for NHE3. Please note that NHE3 gets phosphorylated and glycosylated (Uniprot ID P48764) and potentially, these modifications are adding ~10kDa extra to the predicted molecular weight. If you want to confirm it 100%, you could try de-glycosylating your protein and then performing a WB on it.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our NHE3/SLC9A3 Antibody - BSA Free and receive a gift card or discount.